close all open/close all

CDS information : Ansam_00050


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction4,420 / 5,670 / + [in whole cluster]
78,327 / 77,077 / - [in contig]
Location4420..5670 [in whole cluster]
complement(77077..78327) [in contig]
TypeCDS
Length1,251 bp (416 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)Na+/H+ antiporter
Gene
Gene (GenBank)asm5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q6BJU7
PmId
[17559408] Characterization of DhKHA1, a gene coding for a putative Na(+) transporter from Debaryomyces hansenii. (FEMS Yeast Res. , 2007)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [Na+/H+ antiporter]
MAAPAGDSLVALLFLDLAVVLALGALLGALARRLGQPSVVGEVAAGIALGPSLLGLLPGD
PVALLFPPEARPPLAFAAQLGLVLFMFLVGCELDVAELRGAGRVVGAVSAGSVVLPFCLG
LGVAALLWPQGGDALALFTAAALSITAFPVLARILAERRMQRTRSGVVALASAAVNDVVA
WCALAVVAGIVTARGPWSAVATLAWTAALVLVAVLLVRPLVGWVARTVGGSPRADAVLFA
VVVQGLLLFALATTAIGLHAVFGAFLFGAVVPKDALREAAPTLVDRVGGLSSLLLPVFFV
VAGLSVDVGGLGWSGAAEALLVLVAACVGKLVGAAGGGLLAGLPARDAAEVGVLMNARGL
TELVVLGVGLELGVLDGRLFTVLVVMALVTTAATGPLLTLIARRSGREVAALEGLR
selected fasta
>putative transporter [Na+/H+ antiporter]
GTGGCGGCCCCGGCGGGCGACTCGCTCGTCGCGCTGCTGTTCCTCGACCTCGCGGTCGTC
CTGGCGCTCGGCGCCCTGCTCGGCGCGCTGGCCAGGCGGCTGGGGCAGCCCTCGGTGGTG
GGGGAGGTCGCGGCCGGGATCGCGCTCGGCCCCAGCCTGCTCGGCCTGCTGCCCGGCGAC
CCGGTGGCGCTGCTGTTCCCGCCCGAGGCGCGCCCGCCGCTGGCGTTCGCCGCCCAGCTC
GGCCTGGTGCTGTTCATGTTCCTGGTCGGCTGCGAGCTGGACGTCGCGGAGCTGCGCGGC
GCGGGGCGGGTGGTCGGCGCGGTGTCGGCGGGCTCGGTCGTGCTGCCGTTCTGCCTCGGG
CTGGGCGTCGCGGCGCTGCTGTGGCCGCAGGGCGGTGACGCGCTCGCGCTGTTCACCGCA
GCCGCCCTGTCGATCACCGCTTTCCCCGTGCTGGCGCGGATCCTGGCCGAGCGGCGGATG
CAGCGCACCCGGTCCGGGGTGGTCGCGCTGGCGAGCGCCGCGGTGAACGACGTGGTGGCG
TGGTGCGCGCTCGCCGTCGTCGCCGGGATCGTGACCGCGCGCGGCCCCTGGTCGGCGGTG
GCCACGCTGGCCTGGACGGCGGCGCTGGTCCTGGTGGCGGTGCTCCTCGTCCGGCCGCTG
GTGGGGTGGGTTGCCCGGACGGTGGGCGGCTCGCCGCGCGCGGACGCGGTGCTGTTCGCG
GTCGTCGTCCAGGGGCTGCTGCTGTTCGCGCTCGCCACCACGGCCATCGGCCTGCACGCG
GTGTTCGGGGCGTTCCTGTTCGGGGCGGTTGTGCCCAAGGACGCGCTCCGGGAGGCCGCG
CCGACCCTGGTGGACCGGGTCGGCGGGCTCAGCTCCCTGCTGCTGCCGGTGTTCTTCGTC
GTGGCCGGGCTGTCCGTGGACGTCGGCGGCCTCGGCTGGTCCGGCGCGGCGGAGGCGCTG
CTGGTGCTCGTCGCCGCGTGCGTCGGCAAGCTGGTCGGCGCGGCGGGCGGCGGTCTGCTC
GCGGGGCTGCCCGCGCGCGACGCGGCCGAGGTCGGCGTGCTGATGAACGCCAGGGGGCTC
ACCGAGCTGGTGGTGCTGGGCGTGGGGCTGGAGCTGGGGGTGCTGGACGGGCGCCTGTTC
ACCGTCCTGGTCGTGATGGCGCTGGTGACGACGGCGGCGACCGGCCCGCTGCTGACGCTG
ATCGCCCGGCGGTCCGGGCGGGAGGTCGCCGCGCTCGAAGGACTCCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [19-402]  5.10000000000004e-64 PF00999
PF00999   Na_H_Exchanger
SignalP
 [1-31]  0.98 Signal
Eukaryota   
 [1-31]  0.462 Signal
Bacteria, Gram-positive   
TMHMM
 [10-30]  Transmembrane (o-i) [37-59]  Transmembrane (i-o) [74-93]  Transmembrane (o-i) [106-128]  Transmembrane (i-o) [134-156]  Transmembrane (o-i) [169-191]  Transmembrane (i-o) [201-223]  Transmembrane (o-i) [236-258]  Transmembrane (i-o) [293-315]  Transmembrane (o-i) [320-342]  Transmembrane (i-o) [379-401]  Transmembrane (o-i)
Transmembrane 11