close all open/close all

CDS information : Ansam_00070


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction7,158 / 6,112 / - [in whole cluster]
75,589 / 76,635 / + [in contig]
Locationcomplement(6112..7158) [in whole cluster]
75589..76635 [in contig]
TypeCDS
Length1,047 bp (348 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-20 O-methyltransferase
Product (GenBank)methyltransferase
Gene
Gene (GenBank)asm7
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)

close this sectionSequence

selected fasta
>C-20 O-methyltransferase [methyltransferase]
MTLTDDEHTAHRHDEGAAAFQALATAAAGWGALRAAVELRLPDLLPDAPTAVPDLAALAG
VAPTRLAQLVAVLADVGVLALDERAHVRHTPLSRALRSTDGLALTRLLTAGWADEAWRGL
AEGVRTDTSPLELVHGRPLFDLLAADPAAAAVFHDAVATGPGDPFDEAIRSALDLTGAAR
VVDVGGGRGRLLAALLREHPVLSGVLFDLPEAVRDAVPELRGDDRVQIRAGDLFADRVGA
ADVYVLRTVLHVLDDAQAVRALANVRADAPAHARVVVVEALSDDEANRTYAAHSSLRLFV
LCGGRERSTAEFAELFDRAGLELRSVTPTGTPYHLLEGAPRLSPRTDG
selected fasta
>C-20 O-methyltransferase [methyltransferase]
GTGACGTTGACCGACGACGAGCACACCGCGCACCGGCACGACGAGGGCGCCGCGGCCTTC
CAGGCGCTCGCGACCGCCGCCGCAGGCTGGGGCGCGCTGCGCGCCGCCGTGGAGCTGCGC
CTGCCCGACCTGCTCCCGGACGCCCCCACCGCCGTCCCCGACCTGGCGGCGCTGGCGGGC
GTCGCGCCGACGCGGCTCGCGCAGCTGGTCGCGGTGCTCGCCGACGTGGGCGTGCTCGCG
CTGGACGAGCGCGCCCACGTCCGCCACACGCCGCTCTCCCGCGCCCTGCGCTCGACCGAC
GGCCTGGCGCTCACCCGCCTGCTCACGGCGGGCTGGGCGGACGAGGCGTGGCGCGGGCTC
GCGGAGGGCGTGCGCACCGACACCTCCCCGCTGGAGCTGGTGCACGGCCGCCCGCTGTTC
GACCTCCTCGCCGCCGACCCGGCCGCCGCCGCGGTGTTCCACGACGCGGTGGCCACCGGC
CCCGGCGACCCGTTCGACGAGGCGATCCGCTCCGCGCTCGACCTGACCGGGGCCGCGCGG
GTGGTCGACGTCGGCGGCGGGCGGGGCAGGCTGCTCGCCGCGCTGCTGCGCGAGCACCCC
GTGCTCTCGGGCGTGCTGTTCGACCTGCCCGAGGCGGTCCGGGACGCGGTTCCCGAGCTG
CGCGGCGACGACCGGGTCCAGATCAGGGCGGGCGACCTGTTCGCGGACCGGGTCGGCGCG
GCGGACGTCTACGTGCTGCGCACGGTCCTGCACGTGCTGGACGACGCGCAGGCCGTGCGG
GCGCTGGCCAACGTCCGCGCCGACGCGCCCGCGCACGCCAGGGTCGTGGTCGTGGAAGCG
CTTTCCGACGACGAGGCCAACCGGACCTACGCGGCGCACAGCAGCCTGCGGCTGTTCGTG
CTGTGCGGCGGGCGCGAGCGCTCGACGGCGGAGTTCGCCGAGCTGTTCGACCGGGCCGGG
CTGGAGCTGCGCTCGGTCACCCCGACCGGGACGCCGTACCACCTGCTGGAGGGCGCCCCA
CGCCTGAGCCCGCGCACGGACGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [87-316]  9.20000000000002e-46 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [19-93]  6.80000000000001e-09 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-340]  6.59999852526376e-12 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit