close all open/close all

CDS information : Ansam_00100


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction15,547 / 25,521 / + [in whole cluster]
67,200 / 57,226 / - [in contig]
Location15547..25521 [in whole cluster]
complement(57226..67200) [in contig]
TypeCDS
Length9,975 bp (3,324 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)asmD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)

close this sectionPKS/NRPS Module

6 methylmalonyl-CoA
7 malonyl-CoA
KS34..408
AT557..862
DH907..1064
KR1321..1499
ACP1580..1650
KS1671..2031
AT2251..2553
dh2592..2732
KR2979..3154
ACP3242..3312

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MSDEKKLRDYLKRALAENERVQQRLRALETAHREPIAVVATACRFPGGVASPEDLWDLVA
RGGDVISGFPADRGWDLDALFDGDPEAQGRSYVREGGFLHDATEFDAAFFGISPREALAM
DPQQRVLLETAWEVVERAGIDPTSLRGSRTGVFTGVVYYDFATRLHPVPEGMEGHLGTGI
APSVISGRVAYVLGLHGPAVTLDTGCSSSLVGLHLAAQALRSGECSLALAGGVTVMSLPG
AFPEFSRQRGLAPDGRCKSFADAADGTAWSEGVGLVLLERLSDAERAGHPVLAVLRGSAV
NSDGASNGLTAPNGVSQQRVIRSALEVAGLRPSDVDLVEAHGTGTRLGDPIEAQAILATY
GQDRAEPVLLGSVKSNLGHTQGAAGAAGLIKVVEALRRGEVPRTLHVDRPSAQVDWSAGN
AALATEHVPWPDRGRPRRAAVSAFGVSGTNAHVVLEGVPAPDLPPRDDRALPLPLSARAE
PALRALAGRVGALLDGPVALADVAGSLADGRARLTHRAVVVAADRAGARTALDALAAGEP
HPDLVTGVADVDGRTAFVFPGQGTAWVGMGARLLTESAVFADSVDRCAAALAPHTDVDLR
AALTGGPLDRVETVQVAAFAIAVSLAGLWRAHGVEPDAVLGHSQGEIAAACVAGALTLED
AALVVALRSRAVAEHLSGRGAMLSVALPPHEVESFGLAVAAVNGPESVVLSGPVADVEAV
LAALTATGVRARRVPVDYASHSPGVDVLREVLATALAPVRPRRAHVPFLSSTTGAWLDGP
ELDAGYWFANLRGAVGFHAATTTLLDAGHRAFVEVSAHPVLTGAVQDSADGRALVTGTLR
RDHGGLHRFRLSAAELHARGVPVDWNAGSGDRWRRVDLPTTPFHRQRCWPDARRAATDQP
GLRAANHPLLDTVVVLAGDDGVVCTGSASTRAHPWLADHAVSGTALLPGACWVELAVRAG
DEVGLPVLDELVVEQPLPLGPRTTPLQVRVGPPDATGRRPVELHSGEGGDWTRHARGHLA
AAAPVTAEDPAEWPPPGAREVDLTGFYERQATTGYGYGPAFRGLRRCWTRDGEVFAEVVL
PGEPGAFGVHPALLDAALHAAAVTAPEGVPVLLPFTWTGVALHATGARALRVRLTTPRAG
ELALTASDGDGRPVVTVDSLVLRPAGDLTATRAPRSLFEVVWTETPALTPAATAPRPVLR
HDVPAASAEDAVCSTLAVVQGFLADPRHADSVLLVVTRGGEGPDGATAATSAVHGLVRSA
QAEEPGRIVLVDTDGSAPDDLITALAAGPEPQLAVRAGRVTAPRLRRAAPEGAAPVLDPE
GTVLVTGGTGVLGAAVARHLVTARGARHLLLLSRRGPDAPGAADLVAELTGAGARVVVRA
VDVADRAALAAALDAVPAAHPLTGVVHLAAALDDGTITALTPDRVRRVLAPKATAAAHLH
ELTSDLALFALFSSASGVLGAPGQGNYAAANAYLDGLARERHAAGLPATSIAWGLWAEAT
GLTGSLSGTDRERMAASGVRPLTEAEGLALFDAALAGPAFVAAGLAGTATGQVPPVLRDV
VRAARPAAAAVRPARTPADLLALVRAESASVLGHPAGEPVDADRAFKEAGFDSLTAVELR
NRLTAATGVRLPATLVFDHPTPAALAAHLVERMGAPPAPRPERAARAASGEPIAIVSIGC
RLPGGVTSPDGLWRLLLDGVDATTGPPDDRGWDPATPYRGGFLDGATAFDAGLFGIGPRE
ALAMDPQQRLLLETSWELFERAGIDPTSLRGTDTGVFAGVMNQDYLSRAAGAPPDAEGFL
STGNSGSVVSGRLAYTYGLEGPALTVDTACSSSLVAVHLAVRSLRSGECSLALAGGVTVM
ATTGLFADFDRQGGLAADGRCKAFSADADGTAFGEGAGLVLLERLSDARRNGHAVLAVLR
GTAVNSDGASNGLTAPNGPAQQRVIRAALADAGLSPAEVDVVEAHGTGTRLGDPIEAQAV
LATYGRDRGEPVLLGSVKSNLGHTQGAAGVTGLIKLVLALRHGVVPATLHAGRASAEVNW
EAGAAELVTGTRPWPRTGRPRRAAVSSFGISGTNAHAVLEQAPPGPEAAPVGGPRAGAAS
AGSGAVGARGAEPVGVARAAGAREPEAGGAVDPGGVCPAPAVGAATRAPDPEAAAPGVPG
PAARPVGAGPDGSARTVDVVGASGPLVPLVVSARDERALAAQVERITALPHDPVDVGWSL
VTTRATLRHRAVLLDGEVVASGVPAPGGTAWLFTGQGGYRPGTGRALRARFPAFRDAFDA
TCAELDRALDGRAEHPVRAVALGERPGLDGTLHAQTAAFALQTALAAQLGAFGLAPDAVA
GHSVGEIAAAHVAGAFPLDAACALVAERGVLMRDLRPGAMVAVEVTEEEALDAIGDLPVA
VAVVNGPEAVVLSGDAEAVVAVAARLGGRRKRLPVDRAFHSPHVDPVLDALRGLATGTPT
TPLISTTTGRTLTHVGHDHWADHARGAVRFADALRALAGSGVTTAVELGPDAVLTPHAAE
VLARAIPALRADHDEVVALLTALAVLHARGAAVDWRPAFEGAGARRVDLPTYPFQRTRYW
LDAAPRATATGHPLVDALDVLPGDEVLLSARWHAGRAGLGATPLAALLEPVIRAGDEVGC
PVVAELDLATPVPLDAGPRHVRVRVTAPDADGRRAVTVHSRPDDEPAWTGHATGVLAPAG
HPEPLPHDSEALAVGTNGAWPPAGADVPAAGANGASLPHGAGTPAAATNGARSALPAAGP
APGAELVLPDGAAPDGFGLHPALWEALLPHPARCADVVLHATGATALRVRGTSPLLAVDG
AGDPVVSVGGVTRVAASPRAVTRGSLFEVVEVPLPAPAPPGPSTALSADLSTALSADLRG
VTPAEALDVLQRFAASDAPRLVVRTDRPDDPWQCAVRGLVRSAQAEEPGRILLVVQDGDG
PEPPPTTREPEVVVRDGALRVPRLRRTAPRHDGVRALPDTVLITGGTGALGSTLARHLAA
GGVRTLVLASRRGPAAPGAPELAADLAGLGARAHLVAADLTDRAALAALLAEHRPGGVVH
TAGVLDDGVLSALTPARLDAVLAPKALVAAHLDELTRDGTTTLFVLFSSAAGVLGTPGQA
NYAAANAFLDGLAARRRAAGLHALSLAWGPWRSGMAAGVDASRAGLHPLDDAEATALFDA
ALADGRPLLAPLSLAATPQDADVPPLLRQLVPVRRRSARAEVAPDPVDRLRGAADHELPE
LLLTLVRAATATVLGHRGPESVDPDEPFWDTGFTSLTAVELRNLLAERTGVRVTAAAVYE
EPTPRALSAHLRAALRAPHTSGTV
selected fasta
>polyketide synthase [polyketide synthase]
GTGTCCGACGAGAAGAAGCTGCGCGACTACCTCAAGCGCGCGCTGGCCGAGAACGAGCGG
GTCCAGCAGCGCCTGCGCGCGCTGGAGACCGCGCACCGCGAGCCGATCGCGGTCGTGGCC
ACCGCCTGCCGGTTCCCCGGCGGCGTCGCCTCGCCCGAGGACCTGTGGGACCTGGTGGCG
CGCGGCGGCGACGTCATCTCCGGGTTCCCCGCCGACCGGGGCTGGGACCTCGACGCCCTG
TTCGACGGGGACCCCGAGGCGCAGGGCCGCTCCTACGTCCGCGAGGGCGGGTTCCTGCAC
GACGCCACCGAGTTCGACGCCGCCTTCTTCGGCATCAGCCCCCGCGAGGCGCTGGCGATG
GACCCCCAGCAGCGCGTGCTGCTGGAGACCGCCTGGGAGGTCGTCGAGCGCGCCGGGATC
GACCCGACCTCGCTGCGCGGCAGCCGGACCGGCGTGTTCACCGGGGTCGTCTACTACGAC
TTCGCCACCCGCCTGCACCCCGTGCCCGAGGGCATGGAGGGCCACCTGGGCACCGGCATC
GCCCCCAGCGTCATCTCCGGCCGGGTCGCCTACGTCCTCGGCCTGCACGGACCGGCCGTC
ACCCTGGACACCGGCTGCTCCTCCTCGCTGGTCGGCCTGCACCTGGCCGCGCAGGCGCTG
CGCTCGGGCGAGTGCTCGCTCGCGCTCGCGGGCGGCGTCACGGTCATGTCGCTGCCCGGC
GCGTTCCCCGAGTTCTCCCGCCAGCGCGGGCTCGCCCCGGACGGGCGCTGCAAGTCGTTC
GCCGACGCCGCCGACGGCACCGCCTGGTCCGAGGGCGTCGGCCTGGTGCTGCTGGAGCGG
CTGTCCGACGCCGAGCGCGCCGGGCACCCGGTGCTGGCCGTGCTGCGCGGCAGCGCCGTC
AACTCCGACGGCGCCTCCAACGGGCTGACCGCGCCCAACGGCGTCTCCCAGCAGCGGGTG
ATCCGCTCCGCGCTGGAGGTCGCGGGCCTGCGGCCGTCCGACGTGGACCTCGTGGAGGCG
CACGGCACCGGCACCCGGCTGGGTGACCCGATCGAGGCGCAGGCGATCCTGGCCACCTAC
GGGCAGGACCGGGCCGAACCGGTGCTGCTGGGCTCGGTCAAGTCCAACCTCGGGCACACC
CAGGGCGCGGCGGGCGCGGCCGGGCTGATCAAGGTCGTGGAGGCGCTGCGGCGCGGCGAG
GTCCCGCGCACCCTGCACGTCGACCGGCCCAGCGCCCAGGTCGACTGGAGCGCCGGGAAC
GCCGCGCTGGCCACCGAGCACGTCCCGTGGCCCGACCGGGGGCGGCCCCGGCGCGCCGCC
GTGTCCGCGTTCGGCGTCAGCGGCACCAACGCCCACGTCGTCCTGGAGGGCGTCCCCGCC
CCCGACCTGCCGCCCAGGGACGACCGCGCGCTGCCGCTGCCGCTGTCCGCGCGCGCCGAA
CCCGCGCTGCGCGCGCTCGCCGGTCGGGTGGGCGCGCTCCTGGACGGGCCGGTCGCGCTC
GCCGACGTCGCCGGTTCCCTCGCGGACGGCCGCGCCCGGCTCACCCACCGCGCCGTGGTC
GTCGCCGCGGACCGCGCCGGGGCGCGGACCGCGCTCGACGCGCTCGCGGCGGGCGAGCCC
CACCCGGACCTGGTCACCGGGGTGGCCGACGTGGACGGCAGGACCGCGTTCGTCTTCCCC
GGCCAGGGCACCGCCTGGGTCGGCATGGGCGCGCGGCTGCTGACCGAGTCCGCGGTGTTC
GCCGACTCGGTCGACCGCTGCGCCGCCGCGCTCGCCCCGCACACCGACGTCGACCTGCGC
GCCGCCCTCACCGGCGGCCCCCTCGACCGGGTCGAGACCGTGCAGGTCGCCGCGTTCGCC
ATCGCCGTGTCCCTCGCCGGGCTGTGGCGCGCGCACGGAGTCGAACCGGACGCCGTCCTC
GGGCACTCCCAGGGCGAGATCGCCGCGGCCTGCGTCGCGGGCGCGCTCACCCTGGAGGAC
GCCGCGCTGGTCGTGGCGCTGCGCAGCCGCGCGGTGGCCGAGCACCTGTCCGGGCGGGGC
GCGATGCTGTCCGTCGCCCTGCCGCCGCACGAGGTCGAGTCGTTCGGGCTCGCGGTCGCG
GCGGTCAACGGGCCGGAGTCCGTCGTGCTGTCCGGCCCCGTCGCGGACGTGGAGGCCGTG
CTCGCCGCGCTGACCGCGACCGGCGTGCGGGCCCGGCGCGTCCCGGTCGACTACGCCTCG
CACTCGCCGGGGGTCGACGTGCTGCGCGAGGTCCTGGCCACCGCGCTCGCCCCCGTCCGG
CCCCGGCGCGCGCACGTGCCGTTCCTGTCCAGCACCACCGGCGCCTGGCTGGACGGCCCC
GAGCTGGACGCCGGGTACTGGTTCGCGAACCTGCGCGGCGCGGTCGGCTTCCACGCCGCC
ACCACGACCCTGCTGGACGCGGGCCACCGGGCGTTCGTCGAGGTCAGCGCGCACCCCGTG
CTCACCGGCGCGGTGCAGGACAGCGCCGACGGGCGCGCGCTCGTCACCGGCACGCTGCGC
CGCGACCACGGCGGGCTGCACCGGTTCCGGCTCTCGGCCGCCGAGCTGCACGCGCGCGGC
GTCCCCGTCGACTGGAACGCCGGGTCCGGTGACCGGTGGCGGCGCGTGGACCTGCCCACC
ACCCCGTTCCACCGGCAGCGCTGCTGGCCGGACGCCCGCCGCGCGGCCACCGACCAGCCG
GGTCTGCGCGCGGCGAACCACCCGCTGCTCGACACCGTCGTCGTGCTCGCGGGCGACGAC
GGCGTGGTGTGCACCGGTAGCGCCTCCACGCGCGCCCACCCGTGGCTGGCCGACCACGCC
GTGTCCGGGACCGCGCTGCTGCCGGGCGCCTGCTGGGTGGAGCTCGCGGTCCGCGCGGGC
GACGAGGTCGGGCTCCCGGTGCTGGACGAGCTGGTCGTGGAGCAGCCGCTGCCGCTCGGG
CCGCGGACCACGCCGCTGCAGGTGCGGGTCGGCCCGCCGGACGCCACCGGCCGCCGACCG
GTCGAGCTGCACTCGGGGGAGGGCGGGGACTGGACCAGGCACGCGCGCGGGCACCTCGCC
GCCGCGGCGCCCGTGACCGCCGAGGATCCCGCCGAGTGGCCGCCGCCCGGCGCGCGCGAG
GTCGACCTGACCGGGTTCTACGAGCGCCAGGCCACCACCGGCTACGGGTACGGGCCCGCC
TTCCGCGGCCTGCGCCGCTGCTGGACCCGCGACGGCGAGGTGTTCGCCGAGGTCGTGCTG
CCGGGCGAGCCCGGCGCGTTCGGCGTGCACCCGGCGCTGCTGGACGCGGCGCTGCACGCG
GCGGCCGTCACCGCGCCCGAGGGCGTCCCGGTGCTGCTGCCGTTCACCTGGACCGGGGTG
GCGCTGCACGCCACCGGGGCGCGGGCGCTGCGCGTGCGGCTGACCACCCCGAGGGCGGGC
GAGCTGGCGCTGACCGCGTCCGACGGCGACGGCAGGCCCGTGGTCACCGTGGACTCCCTG
GTGCTGCGCCCGGCGGGCGACCTGACCGCCACGCGGGCGCCGCGGTCGCTGTTCGAGGTG
GTGTGGACCGAAACGCCCGCCCTGACCCCGGCCGCGACCGCGCCCAGGCCGGTGCTGCGC
CACGACGTCCCCGCGGCCTCCGCCGAGGACGCGGTGTGCTCCACCCTCGCCGTGGTGCAG
GGGTTCCTCGCCGATCCCCGGCACGCCGACTCGGTGCTGCTCGTGGTCACCAGGGGCGGC
GAGGGCCCGGACGGCGCGACCGCCGCGACGTCCGCCGTGCACGGCCTCGTCCGCTCCGCC
CAGGCCGAGGAGCCCGGCCGGATCGTCCTGGTGGACACCGACGGCTCCGCCCCCGACGAC
CTGATCACCGCGCTCGCCGCCGGACCGGAGCCCCAGCTCGCCGTGCGCGCGGGCCGGGTC
ACCGCGCCGAGGTTGCGCCGCGCCGCCCCCGAGGGCGCCGCACCCGTCCTGGACCCCGAG
GGCACCGTCCTGGTCACCGGCGGCACCGGCGTGCTCGGCGCGGCCGTCGCCCGCCACCTC
GTCACCGCCCGCGGCGCGCGCCACCTGCTGCTGCTCAGCCGCCGGGGCCCCGACGCGCCC
GGCGCGGCCGACCTGGTCGCGGAGCTGACCGGCGCGGGCGCCCGCGTGGTGGTCCGCGCC
GTCGACGTCGCCGACCGCGCCGCCCTCGCCGCCGCGCTCGACGCGGTCCCCGCCGCGCAC
CCGCTCACCGGCGTCGTGCACCTGGCCGCCGCGCTCGACGACGGCACGATCACCGCGCTC
ACCCCCGACCGCGTGCGCCGGGTCCTCGCCCCCAAGGCCACCGCCGCCGCCCACCTGCAC
GAGCTGACCTCCGACCTGGCGCTGTTCGCCCTGTTCTCCTCGGCCTCCGGCGTGCTCGGC
GCGCCGGGCCAGGGCAACTACGCGGCGGCCAACGCCTACCTGGACGGGCTGGCCCGCGAG
CGCCACGCGGCCGGGCTGCCCGCCACCTCGATCGCCTGGGGCCTGTGGGCCGAGGCGACC
GGCCTCACCGGCTCCCTGTCCGGGACCGACCGGGAGCGCATGGCCGCGTCCGGGGTCCGC
CCCCTGACCGAGGCCGAGGGCCTCGCCCTGTTCGACGCCGCCCTCGCCGGACCGGCGTTC
GTCGCGGCGGGCCTGGCGGGGACGGCGACCGGGCAGGTCCCGCCGGTGCTGCGCGACGTC
GTGCGCGCCGCCCGCCCCGCAGCCGCCGCCGTCCGACCCGCGCGCACCCCCGCCGACCTG
CTCGCCCTGGTCCGCGCCGAGTCCGCCTCGGTGCTCGGCCACCCGGCGGGGGAGCCGGTC
GACGCGGACCGGGCGTTCAAGGAGGCCGGGTTCGACTCGCTCACCGCCGTGGAGCTGCGC
AACCGGCTCACCGCCGCCACCGGCGTGCGGCTGCCCGCCACGCTCGTGTTCGACCACCCC
ACCCCGGCCGCGCTCGCCGCCCACCTGGTGGAGCGGATGGGCGCCCCGCCCGCGCCCCGG
CCGGAGCGCGCCGCCAGGGCCGCGTCCGGCGAGCCGATCGCGATCGTCTCGATCGGGTGC
AGGCTGCCCGGCGGGGTCACCTCGCCGGACGGGCTGTGGCGGCTGCTGCTCGACGGCGTG
GACGCCACCACCGGGCCGCCCGACGACCGGGGCTGGGACCCGGCGACCCCGTACCGGGGC
GGGTTCCTGGACGGGGCGACCGCGTTCGACGCCGGGTTGTTCGGCATCGGGCCGCGCGAG
GCGCTGGCGATGGACCCGCAGCAGCGGCTGCTCCTGGAGACCTCCTGGGAGCTGTTCGAG
CGCGCCGGGATCGACCCGACCTCGCTGCGCGGCACCGACACCGGGGTGTTCGCGGGCGTG
ATGAACCAGGACTACCTCAGCCGCGCGGCGGGGGCGCCGCCGGACGCCGAGGGGTTCCTG
AGCACCGGCAACTCCGGCAGCGTCGTCTCCGGCCGCCTCGCCTACACCTACGGGCTGGAG
GGGCCCGCGCTCACCGTCGACACCGCGTGCTCGTCCTCGCTGGTGGCCGTGCACCTGGCG
GTGCGGTCGCTGCGCTCGGGCGAGTGCTCGCTGGCGCTGGCGGGCGGGGTGACGGTCATG
GCCACCACCGGCCTGTTCGCCGACTTCGACCGCCAGGGCGGGCTCGCGGCGGACGGGCGC
TGCAAGGCGTTCTCCGCCGACGCCGACGGCACCGCGTTCGGCGAGGGCGCCGGGCTCGTG
CTGCTGGAGCGGCTGTCCGACGCCCGGCGCAACGGGCACGCCGTGCTGGCCGTGCTGCGC
GGCACGGCGGTCAACTCCGACGGCGCGTCCAACGGCCTGACCGCGCCGAACGGCCCGGCC
CAGCAGCGGGTGATCCGCGCGGCCCTGGCCGACGCCGGGCTGTCCCCGGCCGAGGTGGAC
GTGGTGGAGGCGCACGGCACCGGTACCCGGCTGGGTGACCCGATCGAGGCGCAGGCGGTC
CTGGCGACCTACGGGCGGGACCGGGGGGAGCCGGTGCTGCTGGGCTCGGTGAAGTCCAAC
CTCGGGCACACCCAGGGCGCGGCCGGGGTCACCGGGCTGATCAAGCTGGTGCTGGCGCTG
CGGCACGGGGTCGTGCCCGCGACCCTGCACGCCGGGCGCGCGTCGGCCGAGGTCAACTGG
GAGGCGGGCGCGGCGGAGCTGGTGACCGGGACGCGGCCGTGGCCGCGGACCGGGCGGCCC
CGGCGCGCGGCGGTGTCGTCGTTCGGGATCAGCGGGACCAACGCGCACGCCGTGCTGGAG
CAGGCGCCGCCCGGCCCCGAGGCCGCACCGGTGGGCGGGCCGCGCGCGGGGGCGGCCTCC
GCCGGTTCCGGCGCGGTGGGAGCACGCGGGGCGGAGCCGGTGGGTGTCGCGCGGGCCGCG
GGCGCGCGCGAGCCGGAGGCGGGGGGCGCGGTCGATCCCGGCGGGGTGTGTCCGGCGCCT
GCGGTGGGCGCCGCGACGCGCGCACCCGACCCGGAGGCGGCTGCGCCCGGCGTGCCGGGC
CCGGCGGCGCGGCCGGTGGGCGCCGGGCCGGACGGGTCCGCGCGGACCGTCGACGTGGTG
GGCGCGTCCGGGCCGCTGGTGCCCCTGGTGGTGTCCGCGCGCGACGAGCGCGCGCTGGCC
GCCCAGGTCGAGCGGATCACCGCGCTGCCGCACGACCCGGTGGACGTGGGCTGGTCCCTG
GTCACCACGCGCGCCACCCTGCGCCACCGCGCCGTGCTGCTGGACGGCGAGGTCGTCGCC
TCCGGCGTCCCGGCGCCGGGCGGCACGGCGTGGCTGTTCACCGGGCAGGGCGGCTACCGG
CCGGGCACCGGGCGGGCGCTGCGGGCGCGGTTCCCCGCGTTCCGCGACGCCTTCGACGCC
ACCTGCGCCGAGCTCGACCGCGCGCTCGACGGCCGCGCCGAGCACCCGGTGCGCGCCGTC
GCGCTGGGGGAGCGCCCCGGCCTGGACGGCACCCTGCACGCGCAGACCGCCGCGTTCGCC
CTGCAGACCGCGCTGGCCGCCCAGCTGGGCGCGTTCGGCCTCGCGCCGGACGCGGTGGCG
GGCCACTCGGTCGGCGAGATCGCCGCCGCGCACGTCGCGGGCGCGTTCCCGCTCGACGCG
GCGTGCGCGCTGGTCGCCGAGCGCGGCGTGCTCATGCGCGACCTGCGACCGGGCGCGATG
GTCGCCGTCGAGGTCACCGAGGAGGAGGCGCTGGACGCGATCGGCGACCTGCCCGTCGCG
GTCGCCGTCGTCAACGGCCCGGAGGCGGTCGTGCTCTCCGGCGACGCCGAGGCGGTCGTG
GCCGTCGCGGCCCGCCTCGGCGGGCGGCGCAAGCGGCTCCCGGTGGACCGGGCGTTCCAC
TCGCCGCACGTCGACCCGGTGCTCGACGCCCTGCGCGGCCTGGCCACCGGGACCCCGACC
ACACCCCTGATCTCCACCACCACCGGCCGCACGCTGACCCACGTCGGCCACGACCACTGG
GCCGACCACGCGCGCGGCGCGGTCCGCTTCGCCGACGCCCTGCGCGCCCTGGCGGGCAGC
GGCGTCACGACGGCCGTGGAGCTGGGCCCCGACGCCGTGCTCACCCCGCACGCCGCCGAG
GTCCTGGCCCGCGCGATCCCCGCCCTGCGCGCCGACCACGACGAGGTCGTCGCCCTGCTC
ACCGCGCTGGCCGTGCTGCACGCGCGCGGCGCGGCCGTCGACTGGCGGCCCGCGTTCGAG
GGCGCGGGCGCGCGCCGCGTCGACCTGCCCACCTACCCCTTCCAGCGCACCCGCTACTGG
CTCGACGCCGCACCCCGCGCCACCGCGACCGGTCACCCGCTGGTGGACGCGCTGGACGTG
CTGCCCGGCGACGAGGTCCTGCTGTCCGCGCGCTGGCACGCGGGCCGGGCCGGTCTGGGC
GCGACCCCGCTGGCGGCGCTGCTGGAACCGGTGATCAGGGCGGGCGACGAGGTCGGCTGC
CCGGTGGTGGCCGAGCTTGACCTGGCCACCCCGGTCCCGCTCGACGCGGGCCCCCGGCAC
GTCCGGGTCCGCGTGACCGCCCCGGACGCAGACGGCCGCCGTGCGGTGACCGTCCACTCC
CGACCGGACGACGAGCCCGCCTGGACCGGGCACGCGACGGGCGTGCTCGCCCCGGCGGGC
CACCCGGAACCGCTACCGCACGACTCCGAGGCGCTCGCGGTGGGGACCAATGGCGCGTGG
CCGCCCGCTGGGGCTGATGTCCCGGCGGCGGGAGCCAATGGCGCGTCCTTGCCCCACGGG
GCCGGCACCCCGGCGGCAGCGACCAACGGTGCGCGGTCCGCCCTGCCCGCCGCCGGACCG
GCGCCGGGCGCTGAGCTCGTGCTGCCCGACGGCGCCGCGCCCGACGGCTTCGGCCTGCAC
CCCGCGCTCTGGGAGGCGCTGCTGCCGCACCCCGCCCGCTGCGCCGACGTCGTCCTGCAC
GCCACCGGGGCGACCGCGCTGCGGGTGCGCGGGACCTCGCCGCTCCTGGCGGTCGACGGC
GCGGGCGACCCGGTCGTGTCGGTGGGGGGTGTCACCCGAGTGGCGGCGTCCCCGCGCGCC
GTCACGCGGGGGTCGCTGTTCGAGGTCGTCGAGGTCCCCCTGCCCGCCCCCGCGCCCCCC
GGCCCGTCCACCGCCCTGTCCGCTGACCTGTCCACCGCCCTGTCCGCGGACCTGCGCGGG
GTCACGCCCGCCGAGGCGCTCGACGTGCTCCAGCGCTTCGCCGCGAGCGACGCGCCCCGC
CTGGTCGTGCGCACCGACCGCCCCGACGACCCGTGGCAGTGCGCCGTGCGCGGCCTGGTG
CGGTCCGCGCAGGCCGAGGAACCCGGCCGGATCCTGCTCGTCGTCCAGGACGGCGACGGC
CCCGAACCGCCGCCCACCACGCGGGAACCCGAGGTGGTCGTCCGCGACGGGGCGCTCCGC
GTGCCGCGCCTGCGCCGCACCGCGCCCCGCCACGACGGCGTGCGCGCCCTCCCCGACACC
GTCCTGATCACCGGCGGCACGGGCGCGCTCGGCTCCACCCTGGCCCGCCACCTGGCCGCC
GGGGGAGTGCGGACCCTCGTGCTCGCCAGCAGGCGCGGCCCCGCCGCGCCCGGCGCGCCC
GAACTGGCCGCCGACCTCGCGGGACTCGGCGCGCGCGCCCACCTGGTCGCCGCCGACCTC
ACGGACCGGGCCGCGCTCGCCGCGCTGCTCGCCGAGCACCGACCCGGCGGCGTCGTGCAC
ACCGCGGGCGTCCTGGACGACGGCGTCCTGTCCGCCCTCACCCCCGCCCGGCTGGACGCC
GTGCTGGCGCCCAAGGCGCTGGTGGCCGCCCACCTGGACGAGCTGACCCGCGACGGCACC
ACGACGCTGTTCGTGCTGTTCTCCTCGGCGGCGGGCGTGCTCGGCACCCCCGGCCAGGCC
AACTACGCGGCGGCGAACGCCTTCCTGGACGGCCTGGCCGCACGACGGCGGGCGGCGGGT
CTGCACGCGCTCTCCCTGGCCTGGGGGCCGTGGCGCTCCGGCATGGCCGCCGGGGTCGAC
GCCTCCCGCGCCGGGCTGCACCCGCTGGACGACGCCGAGGCCACCGCCCTGTTCGACGCC
GCCCTCGCCGACGGCCGCCCGCTGCTGGCGCCGCTGAGCCTGGCCGCGACGCCGCAGGAC
GCGGACGTGCCGCCGCTGCTGCGCCAGCTCGTGCCCGTGCGGCGCAGGAGCGCCCGCGCC
GAGGTCGCCCCGGACCCGGTCGATCGGCTGCGCGGGGCCGCCGACCACGAGCTGCCGGAG
CTGCTGCTGACGCTCGTGCGCGCCGCCACCGCCACCGTCCTCGGCCACCGGGGGCCTGAG
TCCGTCGACCCGGACGAGCCCTTCTGGGACACCGGGTTCACCTCGCTCACCGCCGTCGAG
CTGCGCAACCTGCTGGCCGAGCGCACCGGCGTGCGCGTCACCGCCGCCGCGGTCTACGAG
GAGCCGACCCCGAGGGCGCTGTCCGCCCACCTGCGCGCCGCGCTGCGCGCGCCCCACACC
AGCGGGACGGTCTGA
[6] KS34..408
[6] AT557..862
[6] methylmalonyl-CoA738..742
[6] DH907..1064
[6] KR1321..1499
[6] ACP1580..1650
[7] KS1671..2031
[7] AT2251..2553
[7] malonyl-CoA2437..2441
[7] dh2592..2732
[7] KR2979..3154
[7] ACP3242..3312
[6] KS100..1224
[6] AT1669..2586
[6] methylmalonyl-CoA2212..2226
[6] DH2719..3192
[6] KR3961..4497
[6] ACP4738..4950
[7] KS5011..6093
[7] AT6751..7659
[7] malonyl-CoA7309..7323
[7] dh7774..8196
[7] KR8935..9462
[7] ACP9724..9936

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [550-675]  1.60000000000002e-119 G3DSA:3.40.366.10 [738-849]  1.60000000000002e-119 G3DSA:3.40.366.10 [2247-2375]  1.60000000000002e-119 G3DSA:3.40.366.10 [2437-2542]  1.60000000000002e-119 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1321-1486]  3.29999999999997e-57 PF00106 [2980-3141]  7.69999999999997e-53 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1608-1623]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1580-1650]  PS50075 [3242-3312]  PS50075
PS50075   ACP_DOMAIN
 [1572-1667]  3.49999466863949e-23 SSF47336 [3239-3318]  2.800005042611e-18 SSF47336
SSF47336   ACP_like
 [1579-1653]  1.29999999999998e-42 G3DSA:1.10.1200.10 [3242-3315]  1.29999999999998e-42 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1584-1649]  1.3e-13 PF00550 [3246-3311]  8.3e-11 PF00550
PF00550   PP-binding
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  3.99999999999998e-90 PF00109 [1671-1908]  1.99999999999999e-83 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-408]  2.29999999999998e-45 PF02801 [1916-2031]  2.8e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [557-862]  4.80000000000003e-91 PF00698 [2251-2553]  6.49999999999992e-48 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  1e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [554-847]  4.90001027782408e-59 SSF52151 [2248-2540]  5.40001756046195e-48 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [678-737]  6.69999687625999e-15 SSF55048 [2376-2436]  2.79999889404114e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-296]  G3DSA:3.40.47.10 [297-459]  8.1e-126 G3DSA:3.40.47.10 [1673-1920]  G3DSA:3.40.47.10 [1921-2084]  8.1e-126 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-406]  1.3000049540733e-102 SSF53901 [1663-2030]  1.90000694315261e-97 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1322-1507]  5.50000000000008e-69 G3DSA:3.40.50.720 [2980-3155]  5.00000000000001e-65 G3DSA:3.40.50.720 [3190-3195]  5.00000000000001e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1821-1837]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [558-843]  1.59998835313644e-97 SM00827 [2252-2533]  3.89999861795218e-83 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1581-1653]  2.30000440726534e-37 SM00823 [3243-3315]  4.60000044330862e-25 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [907-1064]  2.7000136937899e-70 SM00826 [2592-2732]  2.59999946718995e-15 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-460]  SM00825 [1673-2084]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1321-1499]  1.90000694315261e-57 SM00822 [2979-3154]  9.00000407957278e-49 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit