close all open/close all

CDS information : Ansam_00110


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction25,523 / 26,302 / + [in whole cluster]
57,224 / 56,445 / - [in contig]
Location25523..26302 [in whole cluster]
complement(56445..57224) [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative amide synthase
Product (GenBank)amide synthase
Gene
Gene (GenBank)asm9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O52547
NITE
Rifam_00260
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[10430893] Direct evidence that the rifamycin polyketide synthase assembles polyketide chains processively. (Proc Natl Acad Sci U S A. , 1999)
[11812235] Expression and purification of the rifamycin amide synthase, RifF, an enzyme homologous to the prokaryotic arylamine N-acetyltransferases. (Protein Expr Purif. , 2002)

close this sectionSequence

selected fasta
>putative amide synthase [amide synthase]
MYDTNTYLARLGVEVTRPDRAALTALHRAHLRALHYDNTAAATQDGPVPDNLADLDVDAT
FDGLVTAGRGGICFELNLLFHRLLTDLGFTTTVLSAGVADEEGGFSPDLAHRFTAVHLDG
EVLLADVGFAGPSYLDPIRLAPDEQVQHGCAFRVVEQDGRHLVLRRSRTTDWRPLYEFAT
TPRTLSDWDGFTPRLRRYLDRAVIAGTTLLCRAVDDGHRALVGKRHLVVRDGHETVTTLL
DPAEHARVSAEIRTGICAD
selected fasta
>putative amide synthase [amide synthase]
GTGTACGACACCAACACCTACCTGGCCCGGCTCGGCGTCGAGGTCACCCGCCCCGACCGG
GCCGCGCTGACCGCGCTGCACCGCGCCCACCTGCGGGCGCTGCACTACGACAACACCGCC
GCCGCCACTCAGGACGGCCCCGTTCCCGACAACCTCGCCGACCTGGACGTGGACGCGACC
TTCGACGGGCTCGTCACGGCCGGGCGGGGCGGCATCTGCTTCGAGCTGAACCTGCTGTTC
CACCGGCTGCTCACCGACCTCGGCTTCACCACGACCGTGCTGTCGGCGGGCGTGGCCGAC
GAGGAGGGCGGCTTCAGCCCCGACCTGGCGCACCGGTTCACCGCCGTGCACCTGGACGGC
GAGGTGCTGCTGGCCGACGTGGGCTTCGCCGGACCGTCCTACCTGGACCCGATCAGGCTG
GCCCCGGACGAGCAGGTCCAGCACGGGTGCGCGTTCCGGGTGGTGGAGCAGGACGGCAGG
CACCTCGTGCTGCGCAGGAGCCGCACCACCGACTGGCGCCCGCTCTACGAGTTCGCCACC
ACCCCCAGGACGCTGTCCGACTGGGACGGCTTCACCCCGAGACTGCGCCGCTACCTGGAC
CGCGCGGTGATCGCGGGCACCACCCTGCTGTGCCGCGCGGTCGACGACGGCCACCGGGCC
CTGGTGGGCAAGCGGCACCTCGTGGTCCGTGACGGCCACGAGACGGTGACCACCCTGCTG
GACCCGGCCGAGCACGCGCGCGTGAGCGCCGAGATCCGCACCGGGATCTGCGCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001447 Arylamine N-acetyltransferase (Family)
 [20-248]  2.29999999999998e-63 PF00797
PF00797   Acetyltransf_2
SignalP
 [1-33]  0.269 Signal
Bacteria, Gram-negative   
TMHMM No significant hit