close all open/close all

CDS information : Ansam_00120


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction27,437 / 26,553 / - [in whole cluster]
55,310 / 56,194 / + [in contig]
Locationcomplement(26553..27437) [in whole cluster]
55310..56194 [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductSAM-dependent N-methyltransferase
Product (GenBank)methyltransferase
Gene
Gene (GenBank)asm10
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)
[21681880] N-methylation of the amide bond by methyltransferase asm10 in ansamitocin biosynthesis. (Chembiochem. , 2011)

close this sectionSequence

selected fasta
>SAM-dependent N-methyltransferase [methyltransferase]
MSLPADSPPPGPVEMPDESWTSLGNAGARAQESARADRLFDDPLARAFLDAAGTGNPLLP
DRGGGDPGLLGQITDVIVVKTVFFDAVLARAAAAGVRQVVLLAAGLDARAFRLPWPEGVV
VFEVDLPDVLGFKERVVREVGAEPSCDRRVVAADLRSDWVAALVAAGLDREAPVAWLAEG
ALGLLDEAGCEELMAAVLGASAAGSRFALDHTHDGWKAGEALGGYLEGTGVCLADLVKGG
PREPGGAWLARHGWRVAEYDVVAEAARHGRPAPTLFRVPERRANATILFEAELG
selected fasta
>SAM-dependent N-methyltransferase [methyltransferase]
ATGAGCCTCCCAGCGGACTCACCACCGCCGGGGCCGGTGGAGATGCCCGACGAGAGCTGG
ACGTCGCTGGGCAACGCGGGGGCGCGGGCGCAGGAGTCCGCGCGGGCCGACCGGTTGTTC
GACGACCCGCTGGCGCGGGCGTTCCTGGACGCGGCGGGGACGGGGAACCCGCTGCTGCCC
GACCGGGGTGGCGGTGATCCGGGGCTGCTCGGGCAGATCACGGACGTCATCGTGGTCAAG
ACGGTGTTCTTCGACGCGGTGCTGGCGCGGGCGGCGGCGGCCGGGGTGCGGCAGGTGGTG
CTGCTGGCCGCCGGGTTGGACGCCCGCGCGTTCCGGCTGCCCTGGCCCGAGGGGGTGGTG
GTGTTCGAGGTGGACCTGCCGGACGTGCTGGGGTTCAAGGAGCGCGTGGTGCGGGAGGTC
GGGGCGGAGCCCTCGTGCGACCGGCGGGTCGTCGCGGCGGACCTGCGCTCGGACTGGGTG
GCCGCGCTGGTCGCCGCCGGGCTGGACCGGGAGGCCCCGGTGGCCTGGCTGGCGGAGGGC
GCGCTGGGGCTGCTGGACGAGGCCGGGTGCGAGGAGCTGATGGCGGCGGTGCTCGGGGCC
TCCGCGGCGGGGAGCCGGTTCGCGCTCGACCACACCCACGACGGGTGGAAGGCCGGGGAG
GCGCTGGGCGGGTACCTGGAGGGGACCGGGGTCTGCTTGGCCGACCTGGTGAAGGGGGGT
CCGCGGGAGCCGGGCGGGGCGTGGTTGGCGCGGCACGGGTGGCGGGTGGCGGAGTACGAC
GTCGTGGCGGAGGCGGCACGGCACGGGCGGCCCGCGCCGACCCTGTTCCGGGTGCCGGAG
CGGCGGGCGAACGCGACGATCCTGTTCGAGGCCGAGCTGGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007213 Leucine carboxyl methyltransferase (Family)
 [23-197]  6.40000000000004e-48 PF04072
PF04072   LCM
IPR011610 S-adenosyl-L-methionine-dependent methyltransferase, putative (Family)
 [20-271]  2.09999999999996e-82 TIGR00027
TIGR00027   Mthyl_TIGR00027
SignalP
 [1-36]  0.103 Signal
Bacteria, Gram-negative   
TMHMM No significant hit