close all open/close all

CDS information : Ansam_00130


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction28,984 / 27,434 / - [in whole cluster]
53,763 / 55,313 / + [in contig]
Locationcomplement(27434..28984) [in whole cluster]
53763..55313 [in contig]
TypeCDS
Length1,551 bp (516 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productepoxidase
Product (GenBank)oxygenase
Gene
Gene (GenBank)asm11
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)

close this sectionSequence

selected fasta
>epoxidase [oxygenase]
MSRDGVVERVPVLVVGAGPTGLALACGLRSLGVEALVVDRAGGPATTSRALGVQPRGVEV
LLRLGALGDLPGLVIPLREVRMHSEGRLVSVMPMARMAQASGRAPLLVSQVEVEASLRER
LAALGGAPEWGVELLDCAQDASGVTALLRDGGGERRVRADWVVGCDGARSLVRELAGIGF
PGEQVAEHFLIADVRADWAVDRGVMGSWTRGRDMVSVCPLPGEDRWRLMGPAPAGTAGRL
RDDEVRELVLRQLARCTPHPAEAITRVEWLSSFRIHRRLAEAHRRDRLLLAGDAAAIHHP
FGGQGMNTGLGDAENLAWKLALVASGRAGQELLDTYAAERRPVAAGVLSGTGVTTGLVAA
DNPLVALVRDRVVMPLLNTRLAQGFLWRRASQLGVGYRRGPLAAPGARRGSGPVPGDRVP
DLACHDGGGRTTLHAALRGRWAVLAPDGVGGSTVEAVRGLLGVDAVVGLAPVAGGLAEVL
LVRPDGHLAWRGRPDPEGVAAWLGSALSLVGEGALR
selected fasta
>epoxidase [oxygenase]
GTGAGCCGGGACGGGGTGGTCGAGCGGGTCCCGGTGCTGGTGGTCGGCGCGGGGCCGACC
GGGCTGGCGCTGGCGTGCGGGTTGCGCTCGCTCGGGGTGGAGGCCCTGGTGGTCGACCGG
GCGGGCGGTCCCGCGACCACCTCGCGGGCGCTGGGCGTGCAGCCGCGCGGCGTGGAGGTG
CTGCTGCGGCTGGGCGCGCTGGGCGACCTGCCGGGGCTGGTGATCCCGCTGCGCGAGGTG
CGGATGCACAGCGAGGGCAGGCTGGTGTCGGTGATGCCGATGGCGCGCATGGCGCAGGCG
TCGGGGCGCGCGCCGCTGCTGGTGTCCCAGGTGGAGGTGGAGGCGTCGCTGCGGGAGCGG
CTGGCCGCGCTGGGCGGCGCGCCGGAGTGGGGCGTGGAGCTGCTGGACTGCGCGCAGGAC
GCCTCCGGGGTGACCGCGCTGCTGCGCGACGGCGGCGGTGAGCGGCGGGTGCGGGCGGAC
TGGGTGGTCGGGTGCGACGGCGCGCGCAGCCTGGTGCGGGAGCTGGCGGGCATCGGGTTC
CCCGGCGAGCAGGTGGCCGAGCACTTCCTGATCGCCGACGTGCGCGCGGACTGGGCGGTG
GACCGGGGCGTGATGGGCAGCTGGACGCGCGGGCGCGACATGGTCAGCGTGTGCCCGCTT
CCCGGCGAGGACCGGTGGCGGCTCATGGGCCCCGCGCCCGCCGGGACGGCCGGGCGGCTG
CGCGACGACGAGGTGCGGGAGCTGGTGCTGCGCCAGCTCGCGCGCTGCACGCCGCACCCC
GCCGAGGCGATCACGCGGGTGGAGTGGCTGTCGTCGTTCCGGATCCACCGCAGGCTCGCC
GAGGCGCACCGCCGGGACAGGCTGCTGCTGGCCGGGGACGCCGCCGCGATCCACCACCCG
TTCGGCGGGCAGGGCATGAACACCGGGCTGGGCGACGCGGAGAACCTGGCGTGGAAGCTG
GCGCTGGTGGCGAGCGGGCGGGCCGGGCAGGAGCTGCTGGACACCTACGCGGCCGAGCGC
AGGCCCGTCGCGGCGGGGGTGCTCTCGGGGACCGGGGTGACCACCGGCCTGGTCGCGGCG
GACAACCCGCTGGTGGCGCTGGTGCGGGACCGGGTGGTGATGCCGCTGCTGAACACCCGG
CTCGCGCAGGGGTTCCTGTGGCGCAGGGCCTCCCAGCTGGGGGTCGGGTACCGGCGCGGG
CCGCTGGCCGCTCCGGGCGCCCGGCGGGGATCGGGGCCCGTGCCCGGCGACCGGGTGCCC
GACCTGGCGTGCCACGACGGGGGCGGGCGGACGACGCTGCACGCGGCGCTGCGCGGCCGG
TGGGCGGTGCTGGCGCCGGACGGGGTGGGCGGGTCGACCGTGGAAGCGGTGCGGGGGCTG
CTCGGCGTGGACGCCGTGGTGGGGCTGGCGCCGGTGGCGGGCGGGTTGGCGGAGGTGCTG
CTGGTGCGGCCGGACGGGCACCTGGCGTGGCGCGGGCGGCCGGACCCCGAGGGGGTCGCG
GCGTGGCTGGGGTCGGCGCTGAGCCTGGTCGGGGAGGGGGCGCTGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [10-348]  8.8e-73 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [11-33]  7.4e-41 PR00420 [158-173]  7.4e-41 PR00420 [285-300]  7.4e-41 PR00420 [300-316]  7.4e-41 PR00420 [318-336]  7.4e-41 PR00420 [336-352]  7.4e-41 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit