close all open/close all

CDS information : Ansam_00140


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction30,306 / 28,981 / - [in whole cluster]
52,441 / 53,766 / + [in contig]
Locationcomplement(28981..30306) [in whole cluster]
52441..53766 [in contig]
TypeCDS
Length1,326 bp (441 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Producthalogenase
Product (GenBank)halogenase
Gene
Gene (GenBank)asm12
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)

close this sectionSequence

selected fasta
>halogenase [halogenase]
MLDAIVMGGGPAGSVCAAVLARQGRSVLVLERQEFPRFHIGESMLPYMVGLLERHGLLDA
VREQGYVVKRGGEFIDPTGTKFFRAGVFRADFAKTGDGRHHETFQVERSHFDRVNLDQAR
AAGATVREGAQVVGLLEEGGRVVGVRYREGGVEREERARYVVDATGRAGVVANRFGLRRM
IEDLRMVAVFHHRDGLDEAHNPGHEGDIQVGSHSDGWIWAIPLSADRISVGTVMHRDRLR
GRTPAEAFAEHVERVPRINQRLTGTSATSDFWVETDYSYHSDQVTGPGWVMVGDAGCFGD
PMFSGGVLVGMATGAEAAEALGRALDSPADEEQALTGYSNFFKTGYDTYVRLIFSFYEGE
LLPALAEAHSEAGNLSEADMEMYVVRLLGGDFWSARNPVANALRANPAWSTFSPFEPVHR
CPVYPELDVAELGGLAGTVGR
selected fasta
>halogenase [halogenase]
ATGCTCGACGCGATCGTGATGGGTGGTGGGCCCGCCGGGTCCGTCTGCGCCGCGGTGCTC
GCCCGGCAGGGCCGCTCGGTGCTGGTGCTGGAGCGGCAGGAGTTCCCCCGCTTCCACATC
GGCGAGTCGATGCTGCCGTACATGGTGGGCCTGCTGGAGCGGCACGGCCTGCTCGACGCG
GTGCGGGAGCAGGGCTACGTCGTCAAGCGCGGCGGCGAGTTCATCGACCCGACCGGCACG
AAGTTCTTCCGCGCCGGGGTGTTCCGCGCCGACTTCGCCAAGACCGGCGACGGCCGCCAC
CACGAGACGTTCCAGGTCGAGCGCTCGCACTTCGACCGGGTGAACCTGGACCAGGCGCGC
GCGGCGGGCGCGACCGTGCGGGAGGGCGCGCAGGTCGTCGGGCTGCTGGAGGAGGGCGGC
CGGGTGGTGGGCGTGCGCTACCGCGAGGGCGGGGTCGAGCGCGAGGAGCGCGCCCGGTAC
GTGGTGGACGCCACCGGCCGGGCGGGCGTGGTCGCCAACCGGTTCGGGCTGCGGCGGATG
ATCGAGGACCTGCGCATGGTGGCGGTGTTCCACCACCGCGACGGGCTGGACGAGGCGCAC
AACCCCGGCCACGAGGGCGACATCCAGGTCGGCAGCCACTCGGACGGGTGGATCTGGGCG
ATCCCGCTGTCGGCGGACCGGATCAGCGTCGGCACGGTCATGCACCGCGACCGGCTGCGC
GGGCGCACCCCGGCCGAGGCGTTCGCCGAGCACGTCGAGCGGGTGCCCAGGATCAACCAG
CGGCTCACCGGCACCTCCGCGACCTCGGACTTCTGGGTGGAGACCGACTACAGCTACCAC
TCCGACCAGGTCACCGGCCCCGGCTGGGTGATGGTCGGGGACGCCGGCTGCTTCGGCGAC
CCCATGTTCTCCGGCGGGGTGCTGGTGGGCATGGCCACGGGCGCGGAGGCCGCCGAGGCG
CTCGGGCGGGCGCTCGACTCGCCCGCCGACGAGGAGCAGGCGCTCACCGGCTACTCGAAC
TTCTTCAAGACCGGCTACGACACGTACGTGCGGCTGATCTTCTCCTTCTACGAGGGCGAG
CTGCTGCCCGCGCTGGCCGAGGCGCACTCGGAGGCGGGGAACCTCTCCGAGGCGGACATG
GAGATGTACGTGGTGCGGCTGCTCGGCGGCGACTTCTGGAGCGCGCGCAACCCGGTGGCG
AACGCGCTGCGCGCGAACCCGGCGTGGTCGACGTTCTCGCCGTTCGAGCCGGTGCACCGC
TGCCCGGTGTACCCCGAGCTGGACGTGGCGGAGCTGGGCGGGCTCGCGGGCACGGTCGGC
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [3-25]  1.6999992228405e-06 PR00420 [157-172]  1.6999992228405e-06 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [5-76]  1.9e-10 PF04820 [102-358]  1.5e-19 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit