close all open/close all

CDS information : Ansam_00150


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction30,563 / 31,588 / + [in whole cluster]
52,184 / 51,159 / - [in contig]
Location30563..31588 [in whole cluster]
complement(51159..52184) [in contig]
TypeCDS
Length1,026 bp (341 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative oxidoreductase
Product (GenBank)3-hydroxyacyl-CoA dehydrogenase
Gene
Gene (GenBank)asm13
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q9ADL9
NITE
Soraph_00040
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)
ACC
Q7BQ74
PmId
[16983083] Hydroxymalonyl-acyl carrier protein (ACP) and aminomalonyl-ACP are two additional type I polyketide synthase extender units. (Proc Natl Acad Sci U S A. , 2006)
ACC
P52041
PmId
[8655474] Cloning, sequencing, and expression of clustered genes encoding beta-hydroxybutyryl-coenzyme A (CoA) dehydrogenase, crotonase, and butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative oxidoreductase [3-hydroxyacyl-CoA dehydrogenase]
MPGDTDDPPARALASPSPDGPPPDGPSSLGPSSGGMSPGGAARGGASPGEPGRPAGERPL
LVLGAGVMGCGITALALSRGLPVLLVDPDADRLDAARADVRAHLRTAQLLGVAAGPLGEL
TTATDTGGPREVVAVVEAVTEDAETKAKALTGVCATVPPGTPLVSNTSSIPMGELAPALP
RPGDLVGAHFMNPPYLIPAVEVARGPLTSDAAFAGLTALLARLGRAPVQVGDAPGFVTSR
LLHPMINDAARVVESGTADAAAVDALMRDCLGHREGPLRTADLIGIDNLVDSLRVLRRRT
GDERCEPCDLLLAKVDAGHLGRKSGRGFYDYGHPGREGTGR
selected fasta
>putative oxidoreductase [3-hydroxyacyl-CoA dehydrogenase]
GTGCCCGGCGACACCGACGACCCACCGGCCCGAGCGCTCGCCAGCCCGTCACCCGACGGC
CCGCCACCCGACGGCCCGTCGTCCCTCGGTCCGTCCTCCGGCGGCATGTCGCCCGGCGGC
GCGGCGCGCGGCGGCGCGTCGCCCGGCGAACCGGGCCGCCCGGCCGGGGAGCGCCCGCTG
CTGGTGCTGGGCGCGGGCGTCATGGGCTGCGGGATCACCGCGCTCGCGCTCTCCAGGGGC
CTGCCCGTGCTCCTGGTGGACCCGGACGCCGACCGGCTCGACGCGGCCCGCGCCGACGTG
CGCGCGCACCTGCGGACCGCCCAGCTGCTCGGCGTCGCCGCCGGGCCGCTCGGCGAGCTG
ACCACCGCGACCGACACGGGCGGCCCCCGCGAGGTGGTCGCCGTGGTCGAGGCGGTCACC
GAGGACGCCGAGACCAAGGCCAAGGCGCTCACCGGGGTCTGCGCCACCGTCCCGCCGGGC
ACCCCGCTGGTCTCCAACACCTCCTCCATCCCCATGGGCGAGCTGGCCCCCGCGCTGCCC
AGGCCCGGCGACCTCGTGGGCGCGCACTTCATGAACCCGCCGTACCTGATCCCCGCCGTC
GAGGTAGCGCGCGGCCCGCTGACCTCGGACGCGGCGTTCGCCGGGCTCACCGCCCTGCTC
GCGCGCCTCGGCCGCGCCCCGGTACAGGTCGGCGACGCGCCGGGCTTCGTCACCAGCCGC
CTGCTGCACCCGATGATCAACGACGCGGCGCGCGTCGTGGAGTCGGGCACCGCCGACGCC
GCCGCCGTCGACGCGCTCATGCGCGACTGCCTCGGCCACCGCGAGGGCCCGCTGCGCACC
GCCGACCTGATCGGCATCGACAACCTCGTCGACTCGCTGCGCGTGCTGCGCAGGCGCACC
GGGGACGAGCGGTGCGAGCCGTGCGACCTGCTGCTGGCCAAGGTCGACGCGGGGCACCTC
GGGCGCAAGAGCGGCCGGGGCTTCTACGACTACGGCCACCCCGGCCGTGAAGGGACGGGG
CGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [235-331]  9e-28 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [62-232]  7.10000000000008e-42 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [235-332]  3.00000067992871e-29 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [237-331]  6.00000000000001e-28 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR016040 NAD(P)-binding domain (Domain)
 [59-236]  1.29999999999998e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR022694 3-hydroxyacyl-CoA dehydrogenase (Family)
 [19-341]  PIRSF000105
PIRSF000105   HCDH
SignalP No significant hit
TMHMM No significant hit