close all open/close all

CDS information : Ansam_00160


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction31,585 / 31,857 / + [in whole cluster]
51,162 / 50,890 / - [in contig]
Location31585..31857 [in whole cluster]
complement(50890..51162) [in contig]
TypeCDS
Length273 bp (90 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productacyl carrier protein
Product (GenBank)acyl carrier protein
Gene
Gene (GenBank)asm14
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Family/Domain
FD
IPR009081

close this sectionSequence

selected fasta
>acyl carrier protein [acyl carrier protein]
MTSGTESRTDDVQGAVLDFLRARTGAEWDAERDLFAEGGLSSLFAMELVVHLEQCFDVEI
AGPDLRLDNFRTVRAMTALVDRLRAGGAGG
selected fasta
>acyl carrier protein [acyl carrier protein]
ATGACCTCGGGCACGGAGTCGCGGACCGACGACGTCCAGGGCGCGGTGCTGGACTTCCTG
CGCGCCCGCACCGGCGCCGAGTGGGACGCCGAGCGGGACCTGTTCGCCGAGGGCGGCCTG
TCGTCGCTGTTCGCGATGGAGCTGGTCGTGCACCTGGAGCAGTGCTTCGACGTCGAGATC
GCGGGCCCCGACCTGCGGCTGGACAACTTCCGCACGGTGCGCGCCATGACCGCGCTCGTG
GACCGGCTCCGCGCGGGCGGCGCCGGTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [8-81]  PS50075
PS50075   ACP_DOMAIN
 [8-84]  5.59999989417023e-13 SSF47336
SSF47336   ACP_like
 [15-80]  6.4e-08 PF00550
PF00550   PP-binding
 [10-82]  8.60000000000001e-14 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
SignalP No significant hit
TMHMM No significant hit