close all open/close all

CDS information : Ansam_00170


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction31,892 / 32,965 / + [in whole cluster]
50,855 / 49,782 / - [in contig]
Location31892..32965 [in whole cluster]
complement(49782..50855) [in contig]
TypeCDS
Length1,074 bp (357 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative oxidoreductase
Product (GenBank)acyl-CoA dehydrogenase
Gene
Gene (GenBank)asm15
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q9KIE5
NITE
Asco_00090
PmId
[14623185] Crystal structure of an Acyl-ACP dehydrogenase from the FK520 polyketide biosynthetic pathway: insights into extender unit biosynthesis. (J Mol Biol. , 2003)
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)

close this sectionSequence

selected fasta
>putative oxidoreductase [acyl-CoA dehydrogenase]
MVADRAGEWDLAGELPVAALRELGAAGALCGEVAERHGGLGLGSLDNGELTARTGALCGS
VRSVQTSQGMAAWTVRRLGDQAQRAAVLPRLTGGSLAAVALSEPGAGSDLSAMATTVEDD
PGEPGTVLVRGHKVWTTAARYADLLLVAGRRGDGAAVALVPATAPGVTITPVANPMGCRA
AGHADVELDDVRLPATSVLGGDGVSTALLVTTVLAHGRLSVAWGCVGILRACLAASAEHA
RTRRQFGVPLAAHQLVAGHLADLLVAEQVSTRVCEHASRRWDESSAELVTATVLAKHVSA
GHAARAAATAVQVLASAGAHDGHPVARAYRDAKLMEIIEGSNELCRLVLAEHAVATA
selected fasta
>putative oxidoreductase [acyl-CoA dehydrogenase]
GTGGTCGCCGACCGGGCGGGGGAGTGGGACCTGGCGGGCGAGCTGCCGGTGGCCGCGCTC
CGCGAGCTCGGCGCGGCGGGCGCGCTGTGCGGTGAGGTCGCCGAGCGGCACGGCGGCCTC
GGGCTCGGCAGCCTGGACAACGGCGAGCTGACCGCCCGCACCGGCGCGCTGTGCGGCTCG
GTGCGCAGCGTCCAGACCTCGCAGGGCATGGCCGCCTGGACCGTGCGCCGCCTCGGCGAC
CAGGCGCAGCGCGCCGCCGTGCTGCCCAGGCTCACCGGGGGCTCGCTGGCCGCCGTGGCG
CTCAGCGAGCCCGGCGCGGGCAGCGACCTGTCCGCCATGGCCACCACCGTCGAGGACGAC
CCCGGCGAACCGGGGACGGTCCTGGTGCGCGGCCACAAGGTGTGGACCACCGCGGCCCGC
TACGCCGACCTGCTCCTCGTGGCGGGCAGGCGCGGCGACGGCGCGGCGGTCGCGCTGGTG
CCCGCCACCGCGCCCGGTGTCACGATCACCCCCGTCGCCAACCCGATGGGCTGCCGGGCC
GCGGGCCACGCCGACGTCGAGCTGGACGACGTGCGCCTGCCCGCCACCTCGGTGCTGGGC
GGCGACGGCGTCTCCACCGCGCTGCTGGTCACCACGGTCCTCGCGCACGGCAGGCTGTCC
GTGGCGTGGGGCTGCGTCGGCATCCTGCGCGCCTGCCTGGCCGCGTCCGCCGAGCACGCC
CGCACCCGCCGCCAGTTCGGCGTGCCGCTGGCCGCGCACCAGCTCGTCGCGGGCCACCTC
GCCGACCTGCTGGTCGCCGAGCAGGTCTCCACCAGGGTGTGCGAGCACGCCAGCCGCCGC
TGGGACGAGAGCTCGGCCGAGCTGGTCACCGCCACCGTGCTCGCCAAGCACGTGAGCGCG
GGGCACGCGGCGCGCGCCGCCGCCACCGCCGTCCAGGTGCTCGCCTCGGCGGGCGCCCAC
GACGGCCACCCCGTCGCGCGCGCCTACCGGGACGCCAAGCTCATGGAGATCATCGAGGGC
AGCAACGAGCTGTGCAGGCTCGTGCTGGCCGAGCACGCGGTGGCGACGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006089 Acyl-CoA dehydrogenase, conserved site (Conserved_site)
 [100-112]  PS00072
PS00072   ACYL_COA_DH_1
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [210-353]  4.6e-30 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [98-192]  3.7e-25 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
 [98-151]  9.8e-13 PF02770
PF02770   Acyl-CoA_dh_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [3-94]  8.69999999999999e-11 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [193-354]  3.2e-38 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [201-355]  3.69999438558106e-32 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [2-203]  5.30001985225035e-47 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [2-94]  3.8e-19 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit