close all open/close all

CDS information : Ansam_00180


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction33,046 / 34,359 / + [in whole cluster]
49,701 / 48,388 / - [in contig]
Location33046..34359 [in whole cluster]
complement(48388..49701) [in contig]
TypeCDS
Length1,314 bp (437 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glyceroyl-ACP biosynthesis protein
putative 1,3-bisphospho-D-glycerate phosphatase/glyceroyltransferase
Product (GenBank)unknown
Gene
Gene (GenBank)asm16
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[17076505] On the biosynthetic origin of methoxymalonyl-acyl carrier protein, the substrate for incorporation of "glycolate" units into ansamitocin and soraphen A. (J Am Chem Soc. , 2006)
Related Reference
ACC
Q1G727
NITE
Oxzol_00080
PmId
[16895402] The bifunctional glyceryl transferase/phosphatase OzmB belonging to the HAD superfamily that diverts 1,3-bisphosphoglycerate into polyketide biosynthesis. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative glyceroyl-ACP biosynthesis protein [unknown]
MLDERVRAAIVELDARGVLQSVASRNDPEPALAALEALGVAEYFVLPEIGWGVKSAAVAR
IADRLGFAHRAIAFVDDRPAERAEVAFHLPEVRCYPAERVLELCSLPEFSPAVVTEDARN
RRALYRAGFARGAEQAAFTGPDEEFLRSLGLVLRIDRARPEDLHRVEELTARTSQMNATG
VHYPHGQLRALLDDPAHEVLVAGLTDRFGPHGAIGIVLLERHTAAWHLKLLATSCRVVPY
GVGSVLLDWLCGQALEAGAHLVADFRRTDRNRMMEIAYRFAGYDDADCACRAELAAVGGG
PEHLAAAGAPGAGAPGIGASGAGASGAGAPAGGAPAGGAPGTGAAETRAAEPRAAESRVA
EPRAAESRVAEPRAAESRVAEPRTAEPRAADVPVAEVPEARASGNPVRRLHLRPAPRPAP
RAVTVEAPSLLEVPTRG
selected fasta
>putative glyceroyl-ACP biosynthesis protein [unknown]
GTGCTGGACGAGCGGGTCCGCGCCGCGATCGTCGAGCTGGACGCGCGCGGCGTGCTCCAG
TCGGTGGCCAGCCGCAACGACCCCGAGCCCGCCCTCGCCGCGCTGGAGGCGCTGGGCGTC
GCCGAGTACTTCGTGCTGCCCGAGATCGGCTGGGGCGTCAAGTCCGCCGCCGTCGCCCGC
ATCGCCGACCGGCTGGGCTTCGCGCACCGCGCCATCGCGTTCGTCGACGACCGGCCCGCC
GAGCGCGCCGAGGTCGCCTTCCACCTGCCCGAGGTCCGCTGCTACCCGGCCGAGCGCGTG
CTGGAGCTGTGCTCGCTGCCCGAGTTCAGCCCCGCCGTCGTCACCGAGGACGCCCGCAAC
CGCCGCGCCCTCTACCGGGCCGGGTTCGCGCGCGGCGCCGAGCAGGCCGCGTTCACCGGG
CCCGACGAGGAGTTCCTGCGCTCGCTGGGACTGGTGCTGCGGATCGACCGGGCCAGGCCC
GAGGACCTGCACCGGGTCGAGGAGCTGACCGCGCGCACCAGCCAGATGAACGCGACCGGC
GTGCACTACCCGCACGGGCAGTTGCGCGCCCTGCTGGACGACCCGGCGCACGAGGTGCTG
GTGGCGGGCCTGACCGACCGGTTCGGGCCGCACGGCGCGATCGGCATCGTGCTGCTGGAG
CGGCACACCGCCGCGTGGCACCTGAAGCTGCTGGCGACCTCGTGCCGGGTGGTGCCCTAC
GGCGTGGGCAGCGTGCTGCTGGACTGGCTGTGCGGGCAGGCGCTGGAGGCGGGCGCGCAC
CTGGTGGCCGACTTCCGGCGCACCGACCGCAACCGCATGATGGAGATCGCCTACCGGTTC
GCCGGGTACGACGACGCCGACTGCGCCTGCCGCGCCGAGCTGGCGGCGGTGGGCGGCGGC
CCCGAACACCTCGCTGCGGCAGGCGCCCCAGGCGCGGGCGCTCCGGGGATCGGCGCCTCG
GGAGCCGGTGCTTCAGGAGCCGGTGCTCCCGCGGGCGGTGCTCCCGCGGGCGGTGCTCCA
GGAACCGGTGCTGCCGAGACTCGCGCTGCCGAGCCTCGCGCTGCCGAGTCTCGCGTGGCT
GAGCCCCGCGCTGCCGAGTCTCGCGTGGCTGAGCCCCGCGCTGCCGAGTCTCGCGTGGCT
GAGCCCCGGACCGCCGAGCCCCGCGCCGCTGATGTCCCCGTCGCCGAGGTTCCCGAGGCG
CGTGCCAGCGGGAACCCGGTGCGGCGGCTGCACCTGCGCCCCGCGCCCCGACCCGCCCCG
CGCGCGGTCACCGTCGAAGCCCCGTCGCTGCTGGAGGTGCCCACCCGTGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010037 FkbH domain (Domain)
 [5-286]  2.50000000000001e-84 TIGR01686
TIGR01686   FkbH
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [154-284]  9.20000000000002e-07 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
 [153-262]  6.80000200614765e-08 SSF55729
SSF55729   Acyl_CoA_acyltransferase
IPR023214 HAD-like domain (Domain)
 [4-79]  2.3e-05 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
SignalP
 [1-33]  0.144 Signal
Bacteria, Gram-positive   
 [1-24]  0.085 Signal
Eukaryota   
TMHMM No significant hit