close all open/close all

CDS information : Ansam_00190


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction34,352 / 35,014 / + [in whole cluster]
48,395 / 47,733 / - [in contig]
Location34352..35014 [in whole cluster]
complement(47733..48395) [in contig]
TypeCDS
Length663 bp (220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative O-methyltransferase
Product (GenBank)O-methyltransferase
Gene
Gene (GenBank)asm17
EC number2.1.1.-
Keyword
  • methoxymalonyl-ACP
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
P28034
PmId
[1894629] Molecular cloning, induction and taxonomic distribution of caffeoyl-CoA 3-O-methyltransferase, an enzyme involved in disease resistance. (J Biol Chem. , 1991)
[9037150] Structure of the parsley caffeoyl-CoA O-methyltransferase gene, harbouring a novel elicitor responsive cis-acting element. (Plant Mol Biol. , 1997)

close this sectionSequence

selected fasta
>putative O-methyltransferase [O-methyltransferase]
MGEQVVVTPALLDYLREVSQPEPAALAELRAETALLPGGGVLPVPPGEGAFLAMLVALTG
ARLVVEVGTFTGCSTLCLASALPDGGRVITCELSPKWPAIARPHWERAGVADRIEVLVGD
AAGSLAGLTGELAGRVDLVFVDADKAGYPRYYELAVELVRPGGLVVVDNTLFSGRVADPA
AVDPDTEGVRELNRRIAADDRVQAVLLAHADGMTLARRTR
selected fasta
>putative O-methyltransferase [O-methyltransferase]
GTGGGTGAGCAGGTCGTCGTCACGCCCGCGCTGCTCGACTACCTGCGCGAGGTCTCCCAG
CCGGAACCGGCGGCGCTCGCCGAGCTGCGCGCCGAGACCGCGCTGCTGCCCGGCGGCGGC
GTCCTCCCCGTCCCACCGGGGGAAGGCGCTTTCCTCGCCATGCTGGTCGCGCTCACCGGG
GCCCGGCTGGTCGTGGAGGTCGGCACCTTCACCGGGTGCAGCACGCTGTGCCTGGCCTCC
GCCCTCCCCGACGGCGGCCGGGTGATCACCTGCGAGCTGAGCCCCAAGTGGCCCGCGATC
GCCCGGCCGCACTGGGAGCGCGCGGGCGTCGCGGACCGGATCGAGGTGCTCGTCGGCGAC
GCCGCGGGCAGCCTCGCCGGGCTGACCGGCGAGCTCGCGGGCCGGGTCGACCTGGTGTTC
GTGGACGCGGACAAGGCCGGGTACCCCCGCTACTACGAGCTGGCCGTCGAGCTGGTGCGC
CCCGGCGGGCTGGTCGTCGTGGACAACACCCTGTTCTCCGGCCGGGTCGCCGACCCCGCC
GCGGTGGACCCCGACACCGAGGGCGTCCGGGAGCTCAACCGCAGGATCGCCGCCGACGAC
CGGGTCCAGGCCGTGCTGCTCGCGCACGCCGACGGCATGACCCTGGCCCGTCGCACGCGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002935 O-methyltransferase, family 3 (Family)
 [17-218]  2.6e-68 PF01596
PF01596   Methyltransf_3
SignalP No significant hit
TMHMM No significant hit