close all open/close all

CDS information : Ansam_00200


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction35,192 / 37,933 / + [in whole cluster]
47,555 / 44,814 / - [in contig]
Location35192..37933 [in whole cluster]
complement(44814..47555) [in contig]
TypeCDS
Length2,742 bp (913 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)transcriptional activator
Gene
Gene (GenBank)asm18
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[26572523] Constitutive overexpression of asm18 increases the production and diversity of maytansinoids in Actinosynnema pretiosum. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>transcriptional activator [transcriptional activator]
MRFQLLGPLEVVDRSRPVALGGTKQRAALGYLLLHPNSVVPTSSLLKALWPQDMPPTGRK
MLQNAVAALRGVLTAAGDAPGAPALLTHTPGYLLRVDPEDVDLSRFRRLVHAGRADLAAG
SWQRAARTLRDAIGLWRGPLLADLVEQGVDWPELAAVRNTRLAALEDCVEAEFASGRYGE
MIYELERWVEAEPLRERLCGQLMRALYHCGRQADALGVYRRTRARLVDELGLDPGRELRE
LERAILNQEVPHRLPARREAAPAARSGATEGGGPVAAPPVAAPPAGIVPQRQAPPAPAPA
PVALAPLPPASAPTAELKHVSVLMVLTRFEHDVAAAPPEEVDDALSDVATAVREEVERAG
GVVTAKAASLIVALFGSTRSGEDDATRAVRAALAVRDRLAHGPRGAGPAALGVTAAVATG
HALVRRHPGRAPEVGGGVLDRCMRLLAHVSPGEVRVCEETRGASEGAIGYDGPHDPVRGS
WATGARQGAGGPPATPPLVDRDRELALLRGLLEQVGRRSRTHLVTVLGEPGIGKSRLVDE
FQRVAETSATVVVRCPRLGGGGDLAPLADALAPRMGIGPADPVGLVAAKLAAAARGSGGA
GERADRVLASLRVLFGLDVPDVLPDGSFAAWRHVLEDLGGADPLVLVLEDLHWAGEALLD
FVDHLTAEATSSPLLVVVTARPELFDRRPAWGGGKAEASTITLDPLADQDVERLLTALCV
RRGPATDEASAAYRAVIAHIGGNPLFAVEYARVLADAGPSSGGGGQSPPLPPLVRRVVAA
RIDSLPADAKAVLLDAAVLGEDLCEEGVRALGGGAVPDVARALEHLERREVLRRDRDAER
ATAYAFRSPLVRDVAYLTIPQHARAEKHRRAADWLERVPGHDALRLVHHGLRSGGCRPTE
PSPVLPQPRQHAR
selected fasta
>transcriptional activator [transcriptional activator]
ATGCGCTTTCAGCTCTTGGGTCCGCTCGAAGTCGTCGACCGGTCCCGACCGGTGGCGCTC
GGCGGCACCAAGCAGCGCGCCGCGCTCGGCTACCTGCTGCTGCACCCGAACAGCGTGGTG
CCCACCAGCAGCCTGCTCAAGGCGCTGTGGCCGCAGGACATGCCGCCCACCGGGCGCAAG
ATGCTCCAGAACGCGGTCGCCGCCCTGCGCGGCGTGCTGACCGCCGCCGGTGACGCGCCC
GGCGCGCCCGCCCTGCTCACCCACACCCCCGGCTACCTGCTGCGCGTCGACCCGGAGGAC
GTGGACCTGAGCCGCTTCCGCAGGCTCGTCCACGCCGGGCGCGCCGACCTCGCGGCGGGC
TCCTGGCAGCGCGCCGCCCGCACCCTGCGCGACGCGATCGGCCTGTGGCGCGGGCCGCTG
CTGGCCGACCTGGTCGAGCAGGGCGTCGACTGGCCCGAGCTGGCGGCCGTGCGCAACACC
CGGCTGGCCGCGCTGGAGGACTGCGTCGAGGCGGAGTTCGCGTCCGGCCGCTACGGCGAG
ATGATCTACGAGCTGGAGCGGTGGGTCGAGGCCGAGCCGCTGCGCGAGCGGCTGTGCGGC
CAGCTCATGCGGGCGCTCTACCACTGCGGCAGGCAGGCCGACGCGCTCGGCGTGTACCGG
CGCACCAGGGCCAGGCTGGTGGACGAGCTGGGGCTCGACCCCGGCCGCGAGCTGCGCGAG
CTGGAGCGGGCGATCCTCAACCAGGAGGTGCCGCACCGGCTCCCGGCCCGGCGCGAGGCG
GCGCCCGCCGCGCGGTCCGGGGCGACCGAGGGCGGTGGCCCGGTCGCGGCGCCCCCGGTC
GCGGCGCCCCCGGCCGGGATCGTCCCGCAGCGGCAGGCGCCCCCGGCGCCCGCGCCTGCC
CCCGTCGCGCTCGCGCCCCTCCCCCCGGCGTCCGCGCCGACCGCCGAGCTCAAGCACGTC
AGCGTCCTCATGGTCCTCACCCGGTTCGAGCACGACGTGGCCGCCGCCCCGCCCGAGGAG
GTGGACGACGCGCTGAGCGACGTCGCCACCGCGGTGCGCGAGGAGGTCGAGCGGGCGGGC
GGCGTCGTCACCGCCAAGGCCGCGTCGCTGATCGTCGCCCTGTTCGGCTCCACCCGCAGC
GGCGAGGACGACGCCACCAGGGCGGTGCGCGCCGCGCTCGCCGTGCGCGACCGGCTCGCC
CACGGGCCGCGCGGCGCCGGGCCCGCCGCGCTGGGCGTCACCGCCGCCGTCGCCACCGGG
CACGCCCTGGTGCGGCGCCACCCAGGGCGCGCGCCCGAGGTCGGCGGCGGCGTGCTCGAC
CGCTGCATGAGGCTGCTCGCGCACGTCTCGCCCGGCGAGGTCAGGGTGTGCGAGGAGACC
AGGGGCGCCAGCGAGGGCGCCATCGGCTACGACGGCCCCCACGACCCGGTGCGCGGGTCC
TGGGCCACCGGGGCCAGGCAGGGCGCGGGCGGGCCCCCGGCCACGCCGCCGCTGGTGGAC
CGGGACCGCGAGCTGGCCCTGCTGCGCGGCCTGCTGGAGCAGGTCGGCCGCAGGTCCCGG
ACGCACCTGGTGACCGTGCTCGGCGAGCCCGGCATCGGCAAGAGCAGGCTCGTGGACGAG
TTCCAGCGCGTGGCCGAGACCTCGGCGACCGTTGTGGTCCGCTGCCCCCGCCTCGGCGGA
GGGGGCGACCTCGCCCCGCTCGCCGACGCGCTCGCCCCGCGCATGGGCATCGGCCCGGCC
GACCCGGTCGGGCTGGTCGCCGCCAAGCTCGCCGCCGCCGCGCGCGGCAGCGGTGGCGCG
GGCGAGCGCGCGGACCGGGTGCTGGCCAGCCTGCGCGTCCTGTTCGGGCTCGACGTGCCC
GACGTGCTCCCGGACGGCTCGTTCGCGGCGTGGCGGCACGTGCTGGAGGACCTCGGCGGC
GCGGACCCGCTCGTCCTGGTCCTGGAGGACCTGCACTGGGCGGGCGAGGCGCTGCTGGAC
TTCGTGGACCACCTCACCGCCGAGGCCACGTCGTCCCCGCTGCTGGTCGTGGTCACCGCG
CGCCCCGAGCTGTTCGACCGGCGCCCCGCCTGGGGCGGCGGCAAGGCCGAGGCCAGCACG
ATCACCCTCGACCCGCTCGCCGACCAGGACGTGGAGCGGCTGCTCACCGCCCTGTGCGTC
CGGCGCGGCCCCGCCACCGACGAGGCGAGCGCCGCCTACCGCGCGGTGATCGCCCACATC
GGCGGGAACCCGCTGTTCGCCGTCGAGTACGCCAGGGTGCTCGCCGACGCGGGCCCGTCG
TCCGGGGGCGGCGGGCAGTCGCCGCCGCTGCCGCCGCTGGTGCGCCGGGTCGTGGCGGCC
CGCATCGACAGCCTGCCCGCCGACGCCAAGGCGGTGCTGCTCGACGCGGCCGTCCTCGGC
GAGGACCTGTGCGAGGAGGGGGTGCGCGCGCTCGGCGGCGGCGCCGTGCCCGACGTGGCG
CGCGCGCTGGAGCACCTGGAGCGGCGCGAGGTCCTGCGCCGGGACCGGGACGCCGAGCGC
GCCACCGCCTACGCGTTCCGCAGCCCGCTCGTGCGCGACGTCGCCTACCTGACCATCCCC
CAGCACGCCCGCGCCGAGAAGCACCGGCGAGCGGCCGACTGGTTGGAGCGCGTGCCCGGT
CACGACGCGCTGCGGCTGGTCCACCACGGGCTCAGGTCGGGCGGGTGCCGCCCGACCGAG
CCCTCGCCGGTGCTCCCGCAACCCCGGCAGCACGCGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001054 Adenylyl cyclase class-3/4/guanylyl cyclase (Domain)
 [306-467]  2.59999946718995e-11 SSF55073
SSF55073   A/G_cyclase
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [15-94]  5.59999989417023e-08 SM00862
SM00862   Trans_reg_C
 [23-94]  3.7e-07 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [101-246]  7.59999999999998e-49 PF03704
PF03704   BTAD
 [101-246]  2.90000354677981e-52 SM01043
SM01043   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [14-96]  4.40000000000001e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-95]  6.09999977126211e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-27]  0.177 Signal
Bacteria, Gram-positive   
TMHMM No significant hit