close all open/close all

CDS information : Ansam_00210


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction37,959 / 39,095 / + [in whole cluster]
44,788 / 43,652 / - [in contig]
Location37959..39095 [in whole cluster]
complement(43652..44788) [in contig]
TypeCDS
Length1,137 bp (378 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductC-3 O-acyltransferase
Product (GenBank)3-O-acyltransferase
Gene
Gene (GenBank)asm19
EC number2.3.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12047169] Identification of asm19 as an acyltransferase attaching the biologically essential ester side chain of ansamitocins using N-desmethyl-4,5-desepoxymaytansinol, not maytansinol, as its substrate. (J Am Chem Soc. , 2002)
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)

close this sectionSequence

selected fasta
>C-3 O-acyltransferase [3-O-acyltransferase]
MTPGPVLPPRLPSLTGIRAPLALLVFVAHALGSARFFADESVNSLGFLLPYGPAALSLFF
VLSGFVLVWSEPWREGVGPYFRRRVVRILPTHVLTWAAVLLLLAALGPLPLLGPLPEVGP
ALVNLSLLQSLVPLPDYLLSVNGINWSVSCEVVFYLLLPLLSRPLLRVPDHRLWACFGVL
AAVVLALPGVIGALVDGPPWALWPPLSFEQAWLVNFFPLTRLPEFLMGVVLARIVATGRW
RPVRAWWPLLGVAAVWALLPVLPQVYARSAIAAVPLALLVPVIAVRDLEGRRSVLSRRWV
RVAGDMSYATYLLHWPLLAVAKHVAGDRLLGLGEGLLLVAALYALTQGLSLLLHRWVERP
LLRRAHRPRRSPAPDPAG
selected fasta
>C-3 O-acyltransferase [3-O-acyltransferase]
ATGACCCCCGGTCCCGTCCTCCCTCCTCGGCTTCCCTCCCTCACCGGCATCCGCGCGCCG
CTGGCCCTGCTCGTGTTCGTGGCCCACGCGCTCGGCTCCGCCCGGTTCTTCGCCGACGAA
TCGGTCAACTCGCTCGGGTTCCTCCTGCCCTACGGGCCCGCGGCGCTGTCGTTGTTCTTC
GTGCTCAGCGGGTTCGTGCTGGTGTGGTCGGAGCCGTGGCGCGAGGGCGTGGGCCCCTAC
TTCCGACGCCGGGTCGTGCGCATCCTGCCCACCCACGTGCTGACGTGGGCCGCGGTGCTG
CTGCTCCTGGCGGCGCTCGGCCCGCTGCCGCTGCTGGGGCCGCTGCCCGAGGTGGGGCCC
GCGCTGGTCAACCTGTCGCTGCTCCAGTCGCTCGTGCCGCTGCCCGACTACCTGCTGTCG
GTCAACGGCATCAACTGGTCGGTGTCCTGCGAGGTGGTGTTCTACCTGCTGCTGCCGCTG
CTGTCCCGGCCGCTGCTGCGGGTGCCCGACCACCGGTTGTGGGCGTGCTTCGGCGTGCTC
GCCGCGGTGGTGCTCGCGCTGCCGGGCGTGATCGGGGCGCTGGTGGACGGGCCGCCGTGG
GCGCTGTGGCCGCCGCTGTCGTTCGAGCAGGCGTGGCTGGTGAACTTCTTCCCGCTGACC
CGGTTGCCGGAGTTCCTGATGGGCGTGGTGCTCGCCAGGATCGTGGCCACCGGGCGGTGG
CGGCCGGTGCGGGCGTGGTGGCCGCTGCTGGGGGTGGCGGCGGTGTGGGCGCTGCTGCCG
GTGCTGCCGCAGGTGTACGCGCGCAGCGCGATCGCGGCGGTCCCGCTGGCGCTGCTCGTC
CCCGTCATCGCCGTGCGGGACCTGGAGGGGCGGCGGTCCGTGCTGTCCCGGCGGTGGGTG
CGGGTCGCGGGGGACATGAGCTACGCGACCTACCTGCTGCACTGGCCGCTGCTCGCGGTC
GCCAAGCACGTGGCGGGGGACCGGCTGCTCGGGCTGGGGGAGGGGCTGCTGCTGGTGGCG
GCGCTGTACGCGCTCACCCAGGGGCTCAGCCTGCTGCTGCACCGGTGGGTGGAGCGTCCG
CTGCTGCGGCGCGCCCACCGGCCGAGGCGGTCGCCCGCCCCGGACCCGGCGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002656 Acyltransferase 3 (Domain)
 [12-350]  3e-25 PF01757
PF01757   Acyl_transf_3
SignalP
 [1-34]  0.939 Signal
Eukaryota   
 [1-30]  0.605 Signal
Bacteria, Gram-negative   
 [1-30]  0.66 Signal
Bacteria, Gram-positive   
TMHMM
 [13-32]  Transmembrane (i-o) [47-69]  Transmembrane (o-i) [90-112]  Transmembrane (i-o) [144-166]  Transmembrane (o-i) [173-195]  Transmembrane (i-o) [210-232]  Transmembrane (o-i) [245-262]  Transmembrane (i-o) [266-285]  Transmembrane (o-i) [298-320]  Transmembrane (i-o) [335-357]  Transmembrane (o-i)
Transmembrane 10