close all open/close all

CDS information : Ansam_00220


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction39,456 / 39,109 / - [in whole cluster]
43,291 / 43,638 / + [in contig]
Locationcomplement(39109..39456) [in whole cluster]
43291..43638 [in contig]
TypeCDS
Length348 bp (115 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)asm20
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MKYMLLIHTSDERWQTLTQADKEEFLAEYAAFTEEIESTGEHCHGSPLTHRRNALSVRVR
DGRAAVERGPLTDDDRYLAGYFVVDCADEDRALEIAARVPDAKLNVVEVRALAVV
selected fasta
>hypothetical protein [unknown]
GTGAAGTACATGCTGCTCATCCACACCAGCGACGAGCGGTGGCAGACCCTGACGCAGGCC
GACAAGGAGGAGTTCCTGGCCGAGTACGCCGCGTTCACCGAGGAGATCGAGTCCACCGGC
GAGCACTGCCACGGCTCCCCGCTGACCCACCGCAGGAACGCGCTGTCCGTGCGGGTGCGC
GACGGCCGCGCCGCCGTGGAGCGCGGCCCGCTCACCGACGACGACCGCTACCTGGCCGGG
TACTTCGTGGTGGACTGCGCCGACGAGGACCGCGCGCTGGAGATCGCCGCGCGCGTGCCC
GACGCGAAGCTGAACGTGGTGGAGGTCAGGGCGCTCGCGGTGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005545 YCII-related (Domain)
 [1-111]  1.1e-11 PF03795
PF03795   YCII
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-115]  1.89999859865865e-29 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP
 [1-20]  0.071 Signal
Eukaryota   
TMHMM No significant hit