close all open/close all

CDS information : Ansam_00230


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction39,480 / 41,684 / + [in whole cluster]
43,267 / 41,063 / - [in contig]
Location39480..41684 [in whole cluster]
complement(41063..43267) [in contig]
TypeCDS
Length2,205 bp (734 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcarbamoyltransferase
Product (GenBank)O-carbamoyltransferase
Gene
Gene (GenBank)asm21
EC number2.1.3.-
Keyword
  • C-7
  • derivative N-glycosyl moiety
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)
[22195559] Dual carbamoylations on the polyketide and glycosyl moiety by asm21 result in extended ansamitocin biosynthesis. (Chem Biol. , 2011)

close this sectionSequence

selected fasta
>carbamoyltransferase [O-carbamoyltransferase]
MRTAVKPGPRRGVNRLWRKGLPLCSPAVEAATANGARVPYRPKWSPATRSPLVPPTRIGP
VTETMLVLGLNGNFSTAAEELVPGMLEFFFHDSSASLARDGELLAAVEEERYNRIKKTTR
FPSAAVRACFEETGLGPDDVDAVAFYFPEDHVDKVLGQLYCQSPAVPLRYSRDLVRDRLR
SELGWDLPAEKLHYVPHHLAHAMSSFGHSGFESALTVVFDGRGENASGTVYRIGPGGVES
LASYPVHRSLGFWYLFGTQLLGYGFGDEYKVMGLAPYGDPARYRSVFESLHSLGEGGEYE
LLGNVVTPNAFLPAMLDTGFAPRRKGEEFTQDHKDFAAALQETVERIALHVIRHWAERTG
ERALCFGGGVAHNSSLNGVILRSGLFDRVFVHPASHDAGAGTGAALAVEHRLTGRVPRVA
LRRADLGGGLGDERDVVLKLKGWDGFVELVHRAADLEDLVDTSARLLADGAVLGWARGRS
EFGPRALGSRSIVADPRPAANQTRINAMVKKRESYRPFAPVVTPDAAAEYFEIPDVEAEL
GFMSFVVPVRPEHRAGLGAVTHVDGTARVQVVTSTANPAFHRLVERFGELTGTPVLLNTS
FNNHAEPIVQTFEDVLTSFLTTELDYLVVGDSVVRRRPDFLGALDDAVIRFRPETRLVGR
VRFPVGGGRVEEHEVFLDYAEGPRKAISARAHGLLTRVDGKSAVAELVDGEVDDALRQEV
LDLWTDRYFTLGPV
selected fasta
>carbamoyltransferase [O-carbamoyltransferase]
GTGCGGACAGCAGTGAAACCAGGGCCTCGCCGGGGTGTCAATCGCCTGTGGCGCAAGGGA
TTACCGCTTTGTTCGCCAGCCGTGGAAGCGGCAACTGCCAACGGCGCCCGCGTGCCCTAC
CGTCCGAAGTGGAGTCCCGCGACCCGGTCTCCGCTCGTCCCTCCCACACGGATTGGCCCG
GTGACAGAGACCATGCTCGTGCTCGGCCTGAACGGCAACTTCTCGACCGCCGCCGAGGAG
CTGGTGCCGGGGATGCTGGAGTTCTTCTTCCACGACTCGTCGGCGAGCCTGGCGCGCGAC
GGCGAGCTGCTGGCCGCCGTGGAGGAGGAGCGGTACAACCGGATCAAGAAGACCACCCGG
TTCCCCAGCGCGGCCGTGCGGGCCTGCTTCGAGGAGACCGGGCTGGGGCCCGACGACGTG
GACGCGGTGGCGTTCTACTTCCCCGAGGACCACGTGGACAAGGTGCTCGGCCAGCTCTAC
TGCCAGAGCCCCGCCGTGCCGCTGCGGTACTCGCGCGACCTGGTGCGCGACCGGCTGCGC
AGCGAGCTGGGCTGGGACCTGCCCGCGGAGAAGCTGCACTACGTGCCGCACCACCTGGCG
CACGCGATGTCCTCCTTCGGGCACTCCGGGTTCGAGTCGGCGCTGACGGTCGTGTTCGAC
GGCCGGGGGGAGAACGCGTCCGGGACCGTCTACCGGATCGGGCCCGGCGGGGTCGAGTCG
CTGGCCTCGTACCCCGTGCACCGGTCGCTGGGGTTCTGGTACCTGTTCGGCACGCAGCTG
CTCGGCTACGGCTTCGGCGACGAGTACAAGGTGATGGGGCTGGCGCCCTACGGCGACCCG
GCCCGCTACCGGTCGGTGTTCGAGTCGCTGCACTCGCTGGGCGAGGGCGGCGAGTACGAG
CTGCTGGGCAACGTGGTCACGCCCAACGCCTTCCTCCCCGCGATGCTCGACACCGGGTTC
GCGCCGCGCCGCAAGGGCGAGGAGTTCACCCAGGACCACAAGGACTTCGCCGCCGCGCTG
CAGGAGACCGTGGAGCGGATCGCGCTGCACGTGATCCGGCACTGGGCCGAGCGGACCGGT
GAGCGCGCGCTGTGCTTCGGCGGCGGGGTCGCGCACAACTCCAGCCTCAACGGGGTGATC
CTGCGGTCGGGGCTGTTCGACCGGGTGTTCGTGCACCCCGCCTCGCACGACGCGGGCGCC
GGGACCGGGGCCGCCCTGGCGGTGGAGCACCGGCTGACCGGGCGGGTGCCGCGCGTGGCG
CTGCGCAGGGCGGACCTCGGTGGTGGGCTCGGGGACGAGCGGGACGTCGTGCTCAAGCTC
AAGGGCTGGGACGGGTTCGTCGAGCTGGTGCACCGGGCGGCGGACCTGGAGGACCTGGTG
GACACCTCGGCCCGGCTCCTCGCGGACGGCGCGGTGCTCGGGTGGGCGCGCGGGAGGTCG
GAGTTCGGGCCGCGCGCGCTGGGCAGCCGCAGCATCGTCGCCGATCCCCGGCCCGCCGCG
AACCAGACCAGGATCAACGCGATGGTGAAGAAGCGGGAGAGCTACCGGCCGTTCGCGCCC
GTGGTCACCCCCGACGCCGCCGCCGAGTACTTCGAGATCCCGGACGTCGAGGCCGAGCTG
GGGTTCATGTCGTTCGTGGTGCCCGTGCGGCCCGAGCACCGGGCCGGGTTGGGCGCGGTG
ACCCACGTGGACGGCACCGCGCGGGTGCAGGTGGTGACCTCGACGGCCAACCCGGCGTTC
CACCGGCTGGTGGAGCGGTTCGGCGAGCTGACCGGCACGCCGGTGCTGCTGAACACCTCG
TTCAACAACCACGCCGAGCCGATCGTGCAGACCTTTGAGGACGTGCTGACCAGCTTCCTG
ACCACCGAGCTGGACTACCTGGTGGTCGGCGACTCGGTGGTCCGCAGGCGCCCGGACTTC
CTGGGCGCGCTGGACGACGCGGTGATCCGGTTCCGCCCCGAGACCAGGCTGGTGGGCCGG
GTGCGGTTCCCGGTCGGTGGCGGTCGGGTGGAGGAGCACGAGGTCTTCCTGGACTACGCG
GAGGGGCCGCGCAAGGCGATCTCGGCGCGGGCGCACGGGCTGCTGACGCGGGTGGACGGG
AAGAGCGCGGTGGCCGAACTGGTGGACGGCGAGGTGGACGACGCCCTCCGACAGGAGGTC
CTCGACCTGTGGACCGACCGGTACTTCACGCTGGGGCCTGTTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003696 Carbamoyltransferase (Family)
 [204-570]  3e-84 PF02543
PF02543   CmcH_NodU
SignalP No significant hit
TMHMM No significant hit