close all open/close all

CDS information : Ansam_00240


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction42,323 / 43,222 / + [in whole cluster]
40,424 / 39,525 / - [in contig]
Location42323..43222 [in whole cluster]
complement(39525..40424) [in contig]
TypeCDS
Length900 bp (299 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative kanosamine kinase
Product (GenBank)kinase
Gene
Gene (GenBank)asm22
EC number
Keyword
  • AHBA
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O52554
NITE
Rifam_00340
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)

close this sectionSequence

selected fasta
>putative kanosamine kinase [kinase]
MSGSGTGGVVGVDLGGTKAAVRVVGADGRSGDSVVRWESGASAGEDLALLVRAVERAGGG
GGVRSVGVAVPATLDRSGVVVAWPGRPGWVGVDVLGALGAMFPGASVRHGDDGDLAALAE
ADAAGCGELLYVGVGTGVGGGIVSGGLPLNSGGSCEVGHVVVERGGGLCDCGRRGCVQAF
ASGPAILRGAVARGGRPGGLGDVRDGVARGERWAVEACEDAASALAALVIGVGELVRPEL
ALIGGGVTTALPGLVPAVAERVAGLGRTGHPVPSVRPAVLGAESSLHGALVLARGGNRE
selected fasta
>putative kanosamine kinase [kinase]
GTGAGCGGTTCGGGTACTGGCGGGGTGGTTGGAGTTGATCTTGGGGGGACGAAGGCCGCT
GTTCGGGTTGTTGGTGCGGACGGGCGGTCGGGCGACAGCGTGGTGCGGTGGGAGAGCGGC
GCTTCTGCTGGCGAAGACCTCGCCTTGCTCGTTCGGGCGGTCGAGCGGGCTGGTGGGGGT
GGGGGTGTCAGGTCGGTTGGTGTCGCTGTGCCTGCCACGCTCGATCGGTCCGGCGTCGTG
GTCGCCTGGCCGGGTCGGCCCGGGTGGGTCGGGGTGGACGTGCTCGGTGCGTTGGGGGCG
ATGTTCCCCGGCGCCTCGGTGCGGCACGGGGATGACGGTGACCTCGCGGCGCTTGCCGAG
GCCGATGCCGCCGGGTGCGGTGAGCTGCTGTACGTCGGTGTGGGCACCGGGGTTGGTGGC
GGGATCGTCTCGGGTGGACTGCCGCTGAACTCGGGTGGCTCGTGCGAGGTGGGGCACGTG
GTCGTCGAACGGGGTGGGGGGCTGTGCGACTGCGGGCGGCGGGGGTGCGTGCAGGCGTTC
GCGTCCGGGCCCGCGATTCTGCGCGGGGCCGTCGCGCGTGGTGGGCGGCCCGGTGGGCTG
GGGGACGTCCGGGACGGGGTCGCGCGTGGGGAGCGGTGGGCGGTGGAGGCTTGTGAGGAC
GCCGCGTCCGCGTTGGCCGCGCTGGTGATCGGGGTGGGGGAGCTGGTTCGGCCCGAGTTG
GCGCTGATCGGCGGTGGTGTCACCACCGCGCTGCCAGGGCTCGTGCCCGCTGTGGCCGAG
CGGGTCGCCGGGCTGGGCAGGACCGGGCACCCGGTGCCATCGGTGCGACCGGCGGTGCTC
GGGGCCGAGTCCTCGCTGCACGGGGCGCTTGTCCTGGCGCGTGGGGGAAACCGGGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000600 ROK (Family)
 [11-186]  8.8e-20 PF00480
PF00480   ROK
SignalP No significant hit
TMHMM No significant hit