close all open/close all

CDS information : Ansam_00250


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction43,921 / 43,487 / - [in whole cluster]
38,826 / 39,260 / + [in contig]
Locationcomplement(43487..43921) [in whole cluster]
38826..39260 [in contig]
TypeCDS
Length435 bp (144 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodehydroquinate dehydratase
Product (GenBank)5-deoxy-5-amino-3-dehydroquinate dehydratase
Gene
Gene (GenBank)asm23
EC number
Keyword
  • AHBA
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q7BUF8
NITE
Rifam_00600
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
ACC
P43877
PmId
[8170389] Characterization of a 3-dehydroquinase gene from Actinobacillus pleuropneumoniae with homology to the eukaryotic genes qa-2 and QUTE. (Mol Microbiol. , 1994)

close this sectionSequence

selected fasta
>putative aminodehydroquinate dehydratase [5-deoxy-5-amino-3-dehydroquinate dehydratase]
MPDLLLLNGPNLGILGRREPEVYGTATLADIEDAVADEVADRGWKVVARQHDGEAEMIGT
IQDSYDTVGAIVNPGALMIAGWSLRDALANYPSPWIEVHLSNVWAREPFRHQSVIAPLAT
GLIAGVGALGYRLAARALLDRVGG
selected fasta
>putative aminodehydroquinate dehydratase [5-deoxy-5-amino-3-dehydroquinate dehydratase]
GTGCCCGACCTGCTCCTGCTGAACGGCCCGAACCTGGGAATCCTGGGCCGCCGCGAACCC
GAGGTGTACGGGACCGCGACGCTCGCCGACATCGAGGACGCGGTGGCCGACGAGGTGGCG
GACCGGGGGTGGAAGGTGGTGGCGAGGCAGCACGACGGCGAAGCCGAGATGATCGGGACC
ATCCAGGACAGCTACGACACGGTGGGCGCTATCGTGAACCCCGGCGCGCTCATGATCGCC
GGCTGGAGCCTGCGGGACGCCCTGGCGAACTACCCGAGCCCGTGGATCGAGGTCCACCTG
TCGAACGTGTGGGCCCGCGAGCCGTTCCGCCACCAGTCCGTGATCGCCCCGCTGGCGACG
GGCCTGATCGCGGGCGTGGGCGCCCTGGGCTACCGCCTGGCGGCACGGGCGCTGCTGGAC
CGGGTCGGGGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001874 Dehydroquinase, class II (Family)
 [17-123]  PD004527
PD004527   DHquinase_II
 [1-144]  1.79999754022378e-66 PIRSF001399
PIRSF001399   DHquinase_II
 [2-142]  1.5e-51 G3DSA:3.40.50.9100
G3DSA:3.40.50.9100   DHquinase_II
 [4-139]  2.4e-46 PF01220
PF01220   DHquinase_II
 [1-143]  1.49999648196323e-46 SSF52304
SSF52304   DHquinase_II
IPR018509 Dehydroquinase, class II, conserved site (Conserved_site)
 [7-24]  PS01029
PS01029   DEHYDROQUINASE_II
SignalP No significant hit
TMHMM No significant hit