close all open/close all

CDS information : Ansam_00260


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction44,141 / 45,307 / + [in whole cluster]
38,606 / 37,440 / - [in contig]
Location44141..45307 [in whole cluster]
complement(37440..38606) [in contig]
TypeCDS
Length1,167 bp (388 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative 3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase
putative AHBA synthase/UDP-3-keto-D-glucose aminotransferase
Product (GenBank)3-amino-5-hydroxybenzoate synthase
Gene
Gene (GenBank)asm24
EC number4.2.1.144
2.6.1.-
Keyword
  • AHBA
Note
  • bifunctional protein
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O52552
NITE
Rifam_00310
PmId
[9497318] 3-Amino-5-hydroxybenzoic acid synthase, the terminal enzyme in the formation of the precursor of mC7N units in rifamycin and related antibiotics. (J Biol Chem. , 1998)
[10433690] Crystal structure of 3-amino-5-hydroxybenzoic acid (AHBA) synthase. (Biochemistry. , 1999)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
[21081954] The biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), the precursor of mC7N units in ansamycin and mitomycin antibiotics: a review. (J Antibiot (Tokyo). , 2011)

close this sectionSequence

selected fasta
>putative 3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase [3-amino-5-hydroxybenzoate synthase]
MHLKAPQKLEFPAWPQFDSTEREALLRTLDSGRWWRITGDEVVSFEREFAQAHGARHALA
VTTGTHALELVLEVMGAGPGTEVIVPAFTFISSSQAAQRLGAVVVPVDVDPDTYCVDPAA
VRAAITERTRAIMPVHMAGQLADMDALRALSAETGVPLLQDAAHAHGARWRGEPLGALGS
IAAFSFQNGKLMTAGEGGAVLLPDGDQHEEAFLRHACGRPLADRAYHHRTAGSNFRMNEF
SAALLRAQLGRLQQQTDVRERHWPVLSRLLAEVPGVVPQGTDPRCDRNPHYMAMFQVPGI
GEERRARLVDALVERGVPAFAGFRAIYRTAAFWERAAPDTTVDALARACPVTEALSSDCV
WLHHRVLLGAEEQMPLVAEAVACALEEA
selected fasta
>putative 3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase [3-amino-5-hydroxybenzoate synthase]
GTGCACCTGAAGGCCCCGCAGAAGCTGGAGTTCCCCGCCTGGCCGCAGTTCGACTCGACC
GAGCGCGAGGCCCTGCTGCGCACGCTCGACAGCGGCCGGTGGTGGCGGATCACCGGGGAC
GAGGTCGTCTCGTTCGAGCGGGAGTTCGCGCAGGCCCACGGCGCCCGGCACGCGCTCGCC
GTCACCACGGGCACGCACGCCCTCGAACTCGTCCTGGAGGTCATGGGCGCCGGGCCTGGC
ACCGAGGTGATCGTGCCCGCGTTCACCTTCATCTCCTCCTCGCAGGCCGCCCAGCGGCTC
GGCGCGGTCGTCGTCCCCGTCGACGTCGACCCGGACACCTACTGCGTCGACCCGGCCGCC
GTGCGGGCCGCGATCACCGAGCGCACCAGGGCGATCATGCCCGTGCACATGGCGGGCCAG
CTCGCCGACATGGACGCGCTGCGCGCCCTGTCCGCCGAGACCGGCGTCCCGCTGCTCCAG
GACGCCGCGCACGCCCACGGCGCGCGGTGGCGCGGCGAGCCCCTCGGCGCGCTCGGCTCG
ATCGCCGCCTTCAGCTTCCAGAACGGCAAGCTGATGACCGCGGGCGAGGGCGGCGCCGTG
CTGCTCCCGGACGGGGACCAGCACGAGGAGGCGTTCCTGCGCCACGCCTGCGGGCGCCCG
CTCGCCGACCGGGCCTACCACCACCGCACGGCCGGGTCGAACTTCCGCATGAACGAGTTC
TCCGCCGCGCTGCTGCGCGCCCAGCTCGGCAGGCTCCAGCAGCAGACCGACGTGCGCGAG
CGGCACTGGCCCGTGCTGTCGCGGCTGCTCGCCGAGGTGCCCGGCGTCGTCCCGCAGGGG
ACCGACCCGCGCTGCGACCGCAACCCGCACTACATGGCCATGTTCCAGGTCCCCGGCATC
GGCGAGGAGCGCCGCGCCCGCCTGGTCGACGCGCTGGTCGAGCGCGGAGTCCCGGCGTTC
GCCGGGTTCCGCGCGATCTACCGCACCGCCGCGTTCTGGGAGCGCGCCGCCCCCGACACC
ACGGTGGACGCCCTCGCCCGCGCCTGCCCGGTCACGGAAGCGCTCAGCAGCGACTGCGTG
TGGCTGCACCACCGGGTGCTGCTGGGGGCGGAGGAGCAGATGCCGCTGGTGGCGGAGGCC
GTCGCCTGCGCGCTGGAGGAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [16-378]  7.90000000000016e-114 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-388]  2.1000026783403e-122 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [13-250]  5.30000000000001e-75 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [251-387]  3.5e-59 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [7-388]  3.39999972437719e-99 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit