close all open/close all

CDS information : Ansam_00270


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction45,706 / 59,760 / + [in whole cluster]
37,041 / 22,987 / - [in contig]
Location45706..59760 [in whole cluster]
complement(22987..37041) [in contig]
TypeCDS
Length14,055 bp (4,684 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)asmA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[16927319] Determination of the cryptic stereochemistry of the first PKS chain-extension step in ansamitocin biosynthesis by Actinosynnema pretiosum. (Chembiochem. , 2006)

close this sectionPKS/NRPS Module

0
1 methylmalonyl-CoA
2 malonyl-CoA
A35..434
PCP921..994
KS1020..1386
AT1535..1839
DH1879..2037
ER2298..2595
KR2605..2783
ACP2865..2935
KS2961..3335
AT3571..3873
DH3915..4077
KR4340..4510
ACP4577..4650

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MLRSDLIRPLPELLREHAAERGDRVAFRDARRAVTWVDLELRTRRLAGHLAARRLLPGDR
AVILLGNRVETVECYLALVRAGAVGVPLNPVSTDAELGALLDDSGARLVLTDAAHADQLA
GLRATRPALEVVHVDRDYEALAGVDAPLPAHDALELDDLAWMLYTSGTTGAPKGVLSTQR
NCLWSVAACYAPVLGLTPDDRVLWPLPLFHSLSHIAGVLATTAVGATTRVVDGRSPQDVL
AALHEERSTVLAGVPTTYHHLVRAAGERGFLAPDLRVGLVGGAITTAELRAAVEQRFGVP
LIDAYGSTETCGSITVNWPTGPRVEGSSGLPVPGLAVRLVDPDTGLDAPTGAEGEVWVRG
PSVMVGYHNRPEATAAALRDGWYRTGDLATRDESGFHAVTGRIDDVVVRGGEKVHPAEVE
AVLRAVPGVADAAVVGRPHDVLGEVPVAFLVPGEGFDPAQVLAVCRERLSYHKVPEELYQ
IESVPRTASGKITRRVLLDTPARLRASGERGALFRTDWVPLAAAPGGATAPGAVAGSGAA
TASSAVTGAGAATGPARATTPAAATAPATTPAEASTPVAAARPGGHPVAVMAEPTAPAPG
GAPVVLDLRGDDAPALSGRPDLVLTRGAVAVDGGPVRLGQLAAWTAACRAGITAVDADDD
GAVDPVGLLAAGEPRLLVRSGVVLVPRLHEVPGSVVGRGALDPRRAVAVTGADSGTAAAL
ARHLRGAHGVRDLLLITAPHGRARAGALRDDLVASGARVVLAVAGPDALDRALSRAPSPL
GALVHTGDGDPEALPRLLGARVELVVCATAFDSAAAEDVVLRRRAAGMPARCLAWGPWEA
ETAQARPGLAVLPLRDGLAAFDAALGADEPVVSVLRPDPDLVAGDVPAPLRDLLHVVAAE
PEPVRVAELRASLAGRGERERRRRLLDLVRAETAALRPAEFLVDGHERGFAELGFTSATS
VALRNRLTAATGLALPATAAFEHPTPTALAALLHDELFGASRTPVAPARAVERPVERSGE
PIAVVAAGCRLPGGVASPEDLWEVVRSGADVVSPFPVDRGWDLDALRGACAGGGFLADAA
LFDAALFGVHPREALAMDPQQRLLLEVAWEVFERAGIDPRSVAGDGTGVFAGLMGHDYGS
RPGLDRQLVEGYLSTGNAGSVASGRIAYAFGLTGPALTVDTACSSSLVAVHLAVQSLRRG
ECSMALAGGATVMATPADFVEFARQGALAPDGRCKPFSASADGTAWSEGAGLVLLERLSD
ARRNGRRVLAVIRGSAVNSDGASNGLTAPSGAAQQRVIRAALADAGLSTSDVDAVEAHGT
GTRLGDPIEARALVATYGRDRDGEPLWLGSLKSNFGHPQGAAGIAGLIKLVQALRHGVLP
RTLHVDAPTPEVDWDGVEVLAEQRAWPEVDRPRRAAVSSFGVSGTNAHVVLEQAPAETAA
PAAPERGPVPLPVSAVDAAALRAQARRLADFLAPSDVTAAELAGALRAGRADLGERAVVV
AADRAGALAALEALAADEPSPALVTGRADVTGRTVLVFPGQGGQWVGMGARLLDESPVFA
ERVGECAAAVDPLVDFRVVDVLRGGDLSRVDVVQPVAFVVMVALARLWRSVGVEPDAVVG
HSQGEIAAACVAGALSLADAARVVVLRSRAIAAGLNGGGMASIPLPQAQVEELVAGTGVC
VAAVNGPGSVVVSGEVDALVARVEGARRLPVDYASHSPAVDVLREGLLADLAPITPRPAA
IPMLSTVTGKWLDGAELDADYWFANLRHPVRFADATALLVADGFRAFVEVGAHPVLTAPV
QDLLAGAGPSVATGTLRRDDGGLDRFLRSAAELHVRGVPVDLSPLAPPPVRALDLPTYPF
QRARYWLDADPTAASALRHPLLTSATDLAGGEDLVCQARLSTARHPWLADHAVRGSAVLP
GTCWAELAIRAGDEVGAPALDELLVEAPLVLPERGAVEVQLRIGAPDAAGRRPLEAHARA
EGGAWTRHASGSLAADRSTPVPLTEWPPTGAREVDLAGFYDSRAAEGYDYGPALRGLRRA
WTRDGEVFAEVELPAPLSPDGWGLHPALFDAALHATGLLPPARVAADEVLLPFSWRGTRL
RATGATALRVRLTGTADDHVLRAYDPEGAPVVEVDALRLRPAPATALVGSGALFRVEWVD
LDLPVSTPDSTPGAPVLDRPVLDLPGGDARTLVGLTLEALREHDELTVVTRGAAEDPAAA
AVWGLLRTAQTERPGRFAVVDLDDDPASRALLPALPATGEPQVRVRAGRASAPRLARTRD
DGLPLPAAPTWRLTCDGGTFTDLAATPSPAANRPLEPGEVRVGVRAAGVNFRDAAVVLNA
VPGQRGLGGEAAGVVLETGPGVTGLAVGDRGLGTFDRDFGAFGPVAVTDARLLAPVPPGW
GFARAASVPVAFLTALYGLRDLAQVGPGDRVLVHAGAGGVGGAAVRLAALLGAEVFATAS
PAKWPVLRALGLDDAHLASSRDTGFAERFPNVDVVLNSLTGELVDASLRLLAPGGRFLEL
GKVDVRDLVRADVTYRAYDLRDAGPDRTAELLAEVLGLFAAGRLEPLPLTVRDVRHAPEA
LRHVASGGHVGKVVLTVPRPLDPEGTVLVHGGGALGALTARHLVSAHGARHLLITSRRGP
DAPGAAELAADLAELGATTRFERCDAADRDRVAALLADLGGRPLTAVVHTAGALDDALLA
DQDAARVDAVLRPKLDGALLLDELTRDADLAAFVLFSSAAGTLGNAGQANYAAANAALDA
LAARRRSAGLPATSIAWGHWEHTSALTAGLTAADLARGARHGAGSLTTTEALALLDAALA
SPEPAVLAAALDPRRAAEVPPLLRDLAGPRRAVAAQAVAGADRPLIDVVRAHTATVLGHR
DASAVDANRAFKELGVDSLTAVELRNRLAAATGLALAATSVFDHPTPALLTAHLLAELGH
APAAGTTAPPATAAVTADAGEPIAIVSMACRFPGDVSSPEDLWDLVAGGGDALTPFPADR
GWDLAALFAPDPDRAGRSHAREGGFLADVAGFDADLFGISPREAIGTDPQQRLLLEVAWE
LFERAGIAPDSLRGTDTGVFAGVIAHGYPVLPAHSDQGLEGHRVTGVSGSVVSGRVAYAF
GLQGPAMTVDTACSSSLVGVHLAVRALRGGECSLALAGGVTVLSTPDLFVDFSRQRGLAA
DGRCKAFGAGADGTGFGEGVGLVLLERLWDARRNGRRVLGLVRGSAVNSDGASNGLTAPS
GPAQERVIGRALADAGLSAADVDLVEAHGTGTRLGDPIEARALVATYGRDRGGEPVWLGS
VKSNIGHTQAAAGVAGLIKAVQALRHGVLPATLHAAEPTPEVEWDGVAVLAEQRDWPEVG
RPRRAAVSSFGVSGTNAHVVLEQAPEELSPEGRIPEVRIPDRRTSEGRVPEGRAPEGRTS
GGRAPEGQTSEGRAFGGRVPEDQTSEDRTSEGQASMGRAPEGQAPLGQVSESRAPDHRVP
AGPDRDVPGHLPLVLSAHDPAALRATAARLLPVAERVPLPDLALSLVTGRAALPCRAVIP
ARDRGQALAALRDLASGATAPAERDGGGVAFLLSGQGSQRAGTGRLLERRFPVFRDALRE
VCALLDRRVVGGPGVRAALDDPGLLADTRYAQAGLFAVQVALVRLLDALGVRPDLLAGHS
VGEIAVAHAAGVLSLEDASTLVAARGALMRELPPGVMVAVRAGEDEARAALVDGVELAAV
NGPRATVLTGDEAAVTEVAARLGRATRLRVAHAFHSAAVDAVLPAFADVLARLDFRPPRV
PVATTAPGALDAPEYWLGQAREPVRFADAVTDLHRRGATAFVEVGPGGGLAAAAQECLDG
HDVLCAPLLHRDRDEDHSLITALGALHARGARVDFAPLLADAGGRTTDLPTYPFQRRRFW
LDPAPPTTDAAPLEHPLLTGELEIPGSDTAAFTGRAATGAHPWLADHRLLDAVVVPGTAL
LDLVRAAGRQLGLPEVAELVNEVPLVLGDGAALLRVTAAAPGPDGRREVAVHSRPESAGP
RSPWTRHVTGQLAPESGPLAFDLAQWPPPGALPLPVADHRAAMAATGHGYGPAFLGLRAA
WKLDDEVLVEAVLPDEVADDGHAVHPALLDAVLQAIALTGVEDGSQVRVPFSWRSARGAG
RAGRAVRASLRPDGDGGVRVRVACPRGRPLLEIASLVSRPVTPDRLRPGVLLRQAWTEVG
PPPGAAEPVPLREVGERVPPVVRVDAGHVRDLLPLLQEVVTEPRWESTRLLVTTSGAVGP
RAGRAEGAAVWGLVRSAAAEHPGRFVLADLDDRPESAALLPALATGALPEAVLRAGRVLV
PGLHRVSAPGAGGAVLDPGGAALITGGSGALAALLAEHLVRAHGVRCLVLLSRSGRGPDV
PGADVRHVRGDVANRADVVAALAAVPPDRPLTLVAHLAGVLDDGALTALTPERLDAVLRP
KAEGARHLDELTRDRDLAAFVLFSSVAGALGHAGQANYAAANAHLDGLAHERHALGLPAT
ALAWGPWTEGMARGRGTLSPQVALGLFDAALRTGLPALVPLDREPERRVPAPRAATPAPA
GPSLADRLRPMPPAERRAHLLELVTAEALGVLGHDDGAALPAGQAFRDAGFDSITAMALR
NRLVRLAGVRLPASVVFDHPTPAATAERLEAELFPADRLPGPRHGDDFDDMAADELVRRA
LGGE
selected fasta
>polyketide synthase [polyketide synthase]
ATGCTGCGAAGCGACCTGATCCGTCCCCTGCCCGAACTGCTGCGCGAGCACGCGGCCGAG
CGCGGCGACCGCGTCGCCTTCCGCGACGCGCGCCGCGCCGTCACCTGGGTCGACCTGGAG
CTGCGCACGCGCAGGCTGGCCGGGCACCTGGCCGCGCGCAGGCTGCTGCCCGGCGACCGC
GCCGTGATCCTGCTGGGCAACCGGGTGGAGACCGTCGAGTGCTACCTGGCGCTGGTGCGG
GCGGGCGCGGTGGGCGTGCCGCTGAACCCGGTGTCCACCGACGCCGAGCTGGGCGCCCTC
CTCGACGACAGCGGCGCCCGGCTCGTCCTCACCGACGCCGCGCACGCCGACCAGCTCGCC
GGGCTCCGCGCCACCCGGCCCGCGCTGGAGGTCGTGCACGTCGACCGGGACTACGAGGCG
CTCGCGGGCGTCGACGCCCCGCTGCCCGCGCACGACGCGCTGGAGCTGGACGACCTGGCG
TGGATGCTCTACACCTCCGGCACCACCGGCGCCCCCAAGGGCGTGCTGTCCACCCAGCGC
AACTGCCTGTGGTCGGTGGCCGCCTGCTACGCGCCCGTGCTCGGTCTGACCCCGGACGAC
CGGGTGCTGTGGCCGCTGCCGCTGTTCCACAGCCTGTCGCACATCGCCGGGGTGCTGGCC
ACCACCGCCGTCGGCGCCACCACCCGCGTGGTCGACGGGCGCTCCCCGCAGGACGTGCTG
GCCGCGCTGCACGAGGAGCGCTCCACGGTGCTCGCGGGCGTGCCCACGACCTACCACCAC
CTGGTGCGCGCGGCCGGTGAGCGCGGGTTTCTCGCGCCCGACCTGCGGGTCGGGCTGGTC
GGCGGCGCGATCACCACGGCCGAGCTGCGGGCCGCCGTCGAGCAGCGGTTCGGCGTGCCG
CTCATCGACGCCTACGGCAGCACCGAGACGTGCGGGTCGATCACCGTGAACTGGCCGACC
GGGCCCAGGGTCGAGGGCTCCAGCGGCCTCCCGGTGCCGGGTCTGGCGGTGCGGCTGGTC
GACCCGGACACCGGCCTGGACGCGCCGACCGGCGCGGAGGGCGAGGTGTGGGTGCGCGGG
CCGAGCGTCATGGTCGGCTACCACAACCGGCCCGAGGCGACGGCCGCCGCGCTGCGCGAC
GGCTGGTACCGCACCGGCGACCTGGCGACCAGGGACGAGTCCGGGTTCCACGCGGTCACC
GGGCGCATCGACGACGTCGTGGTCCGCGGCGGCGAGAAGGTGCACCCGGCGGAGGTGGAG
GCGGTGCTGCGGGCCGTGCCGGGCGTCGCGGACGCCGCCGTGGTGGGCAGGCCGCACGAC
GTGCTGGGCGAGGTCCCGGTGGCGTTCCTGGTGCCGGGGGAGGGGTTCGACCCGGCGCAG
GTGCTGGCGGTGTGCCGGGAGCGGCTGTCGTACCACAAGGTGCCCGAGGAGCTGTACCAG
ATCGAGTCCGTGCCGCGCACGGCCTCCGGGAAGATCACCCGGAGGGTGCTGCTGGACACG
CCGGCGCGGTTGCGGGCGAGCGGTGAGCGGGGGGCGCTGTTCCGCACCGACTGGGTGCCG
CTGGCCGCAGCGCCCGGTGGCGCGACCGCGCCCGGTGCGGTGGCCGGGTCTGGTGCCGCG
ACCGCGTCCAGTGCTGTGACCGGTGCCGGTGCCGCGACCGGTCCTGCCCGTGCGACCACG
CCCGCTGCTGCGACAGCGCCCGCGACCACGCCCGCCGAGGCGTCGACCCCGGTGGCGGCC
GCACGGCCGGGCGGGCATCCGGTGGCCGTCATGGCGGAGCCCACCGCCCCGGCTCCCGGT
GGCGCGCCGGTGGTGCTCGACCTGCGCGGCGACGACGCGCCCGCGCTGTCCGGTCGTCCC
GACCTGGTGCTCACCCGAGGTGCGGTGGCCGTGGACGGCGGGCCGGTGCGGCTCGGGCAG
CTCGCCGCGTGGACCGCCGCCTGCCGCGCCGGGATCACCGCGGTCGACGCCGACGACGAC
GGCGCGGTCGACCCGGTCGGGCTGCTCGCCGCCGGTGAGCCCCGGCTGCTCGTGCGCTCC
GGGGTCGTGCTCGTGCCGCGCCTGCACGAGGTCCCCGGCTCCGTCGTCGGGCGCGGCGCG
CTCGACCCCCGCCGGGCCGTCGCCGTCACCGGGGCGGACAGCGGGACCGCCGCGGCGCTG
GCCCGGCACCTGCGCGGCGCGCACGGCGTGCGCGACCTGCTGCTGATCACCGCTCCCCAC
GGGCGAGCCCGCGCGGGCGCGCTGCGCGACGACCTCGTGGCCTCGGGCGCGCGGGTCGTG
CTCGCCGTCGCCGGACCGGACGCGCTCGACCGCGCGCTCAGCCGGGCGCCGTCCCCGCTG
GGCGCGCTCGTGCACACCGGCGACGGGGACCCGGAGGCCCTGCCCCGCCTGCTCGGCGCG
CGGGTCGAGCTGGTGGTGTGCGCGACCGCGTTCGACTCGGCCGCCGCGGAGGACGTCGTG
CTGCGCCGCCGCGCCGCCGGGATGCCCGCGCGGTGCCTGGCCTGGGGACCGTGGGAGGCC
GAGACCGCGCAGGCCCGGCCGGGGCTGGCCGTGCTGCCGCTGCGGGACGGGCTGGCCGCG
TTCGACGCCGCGCTCGGCGCCGACGAGCCGGTCGTCTCGGTGCTGCGCCCCGACCCCGAC
CTGGTCGCCGGGGACGTGCCCGCGCCGCTGCGCGACCTGCTGCACGTGGTCGCCGCCGAA
CCCGAGCCGGTCCGGGTGGCCGAGCTGCGGGCGAGCCTGGCCGGTCGCGGGGAGCGGGAG
CGCAGGCGGCGGCTGCTCGACCTGGTGCGCGCCGAGACCGCGGCCCTGCGGCCCGCCGAG
TTCCTGGTCGACGGGCACGAGCGCGGCTTCGCCGAACTCGGCTTCACCTCCGCCACCTCG
GTCGCCCTGCGCAACCGGCTCACCGCCGCGACCGGGCTCGCGCTGCCCGCGACCGCCGCG
TTCGAGCACCCCACCCCGACCGCGCTCGCCGCCCTGCTGCACGACGAGCTGTTCGGCGCG
TCGCGGACCCCGGTCGCGCCCGCGCGCGCCGTCGAGCGCCCCGTCGAGCGCTCGGGAGAG
CCGATCGCGGTCGTCGCCGCCGGGTGCAGGCTGCCCGGCGGCGTCGCCTCCCCCGAGGAC
CTGTGGGAGGTCGTGCGCTCCGGCGCGGACGTGGTGTCGCCGTTCCCGGTCGACCGGGGC
TGGGACCTGGACGCGCTGCGCGGCGCCTGCGCGGGCGGCGGGTTCCTGGCCGACGCCGCC
CTGTTCGACGCCGCCCTGTTCGGGGTGCACCCGCGCGAGGCACTCGCGATGGACCCGCAG
CAGCGGCTGCTGCTCGAAGTCGCGTGGGAGGTGTTCGAGCGCGCCGGGATCGACCCGCGC
TCGGTGGCGGGCGACGGGACCGGCGTGTTCGCCGGGCTGATGGGCCACGACTACGGGTCG
CGGCCGGGGCTGGACCGGCAGCTCGTGGAGGGCTACCTGAGCACCGGCAACGCGGGCAGC
GTCGCCTCCGGGCGGATCGCCTACGCGTTCGGGCTCACCGGGCCCGCGCTCACCGTGGAC
ACCGCCTGCTCGTCGTCGCTGGTGGCGGTGCACCTGGCCGTGCAGTCGCTGCGGCGCGGC
GAGTGCTCGATGGCGCTGGCGGGCGGCGCGACGGTCATGGCCACGCCCGCCGACTTCGTC
GAGTTCGCCCGGCAGGGCGCGCTGGCCCCGGACGGCCGCTGCAAGCCGTTCTCGGCGTCG
GCGGACGGGACGGCGTGGTCCGAGGGCGCGGGGTTGGTGCTGCTGGAGCGGCTGTCGGAC
GCGCGGCGCAACGGGCGTCGGGTGCTGGCGGTGATCCGGGGCAGCGCGGTGAACTCGGAC
GGGGCGTCGAACGGGTTGACGGCGCCGAGCGGTGCGGCGCAGCAGCGGGTGATCCGGGCG
GCGCTCGCGGACGCCGGTCTGTCCACTTCGGACGTGGACGCGGTGGAGGCGCACGGGACC
GGGACGCGGCTCGGTGATCCGATCGAGGCCCGCGCGCTGGTCGCGACCTACGGGCGGGAC
CGGGACGGCGAGCCGCTGTGGCTCGGCTCGCTGAAGTCGAACTTCGGGCATCCCCAGGGC
GCGGCCGGGATCGCCGGGCTCATCAAGCTCGTGCAGGCGCTGCGGCACGGGGTGCTGCCG
CGCACCCTGCACGTGGACGCGCCCACCCCCGAGGTCGACTGGGACGGGGTGGAGGTGCTG
GCCGAGCAGCGCGCGTGGCCCGAGGTGGACCGGCCGCGTCGCGCGGCGGTGTCCTCGTTC
GGGGTCAGCGGCACCAACGCGCACGTGGTCCTGGAGCAGGCGCCCGCCGAGACCGCCGCG
CCCGCCGCGCCCGAGCGCGGGCCCGTGCCGCTGCCGGTGTCCGCCGTCGACGCGGCGGCG
CTGCGCGCCCAGGCCCGGCGGCTGGCCGACTTCCTCGCCCCCTCCGACGTCACGGCCGCC
GAGCTGGCGGGCGCGCTGAGAGCCGGCCGGGCCGACCTCGGCGAGCGCGCCGTCGTGGTC
GCCGCCGACCGGGCGGGCGCGCTCGCCGCGCTGGAGGCGCTGGCCGCCGACGAGCCCTCG
CCCGCCCTGGTCACCGGGCGCGCGGACGTCACCGGCCGCACGGTGCTCGTGTTCCCCGGC
CAGGGCGGCCAGTGGGTGGGCATGGGCGCCCGGCTGCTCGACGAGTCCCCGGTGTTCGCC
GAGCGGGTGGGCGAGTGCGCGGCGGCCGTCGACCCCCTGGTGGACTTCCGCGTGGTCGAC
GTGCTGCGCGGCGGCGACCTGAGCCGGGTGGACGTCGTCCAGCCGGTCGCGTTCGTCGTC
ATGGTCGCGCTGGCCCGGCTGTGGCGCTCGGTCGGCGTCGAGCCCGACGCGGTGGTCGGC
CACTCGCAGGGCGAGATCGCCGCCGCCTGCGTCGCGGGAGCGCTCTCACTGGCCGACGCG
GCCCGCGTGGTCGTGCTGCGCAGCCGGGCCATCGCCGCCGGGCTGAATGGCGGCGGCATG
GCCTCGATCCCGCTGCCGCAGGCCCAGGTCGAGGAGCTGGTCGCGGGCACCGGGGTGTGC
GTCGCGGCGGTCAACGGACCCGGTTCGGTGGTCGTCTCCGGCGAGGTCGACGCGCTGGTC
GCCCGCGTGGAGGGCGCCCGCAGGCTGCCGGTGGACTACGCCTCGCACTCGCCCGCCGTG
GACGTGCTGCGCGAGGGCCTGCTCGCCGACCTCGCGCCGATCACCCCCCGACCGGCCGCC
ATCCCGATGCTGTCCACCGTCACGGGGAAGTGGCTGGACGGCGCCGAGCTCGACGCCGAC
TACTGGTTCGCCAACCTGCGCCACCCCGTCCGCTTCGCCGACGCCACCGCGCTCCTGGTC
GCCGACGGGTTCCGGGCGTTCGTGGAGGTCGGCGCCCACCCGGTGCTCACCGCGCCCGTC
CAGGACCTGCTCGCGGGCGCGGGCCCCTCGGTCGCCACCGGCACCCTGCGCCGCGACGAC
GGCGGCCTCGACCGGTTCCTGCGCTCCGCCGCCGAGCTGCACGTGCGCGGCGTGCCCGTC
GACCTCTCCCCGCTGGCGCCCCCGCCGGTCCGGGCGCTCGACCTGCCCACCTACCCGTTC
CAGCGCGCCCGCTACTGGCTGGACGCCGACCCCACCGCCGCCTCCGCGCTGCGGCACCCG
CTGCTCACCTCCGCCACCGACCTCGCGGGTGGCGAGGACCTGGTGTGCCAGGCGCGGCTG
AGCACCGCGCGGCACCCGTGGCTCGCCGACCACGCGGTGCGCGGGTCCGCCGTCCTGCCC
GGCACGTGCTGGGCGGAGCTGGCCATCCGCGCCGGCGACGAGGTCGGCGCGCCCGCGCTG
GACGAGCTGCTCGTGGAGGCACCGCTGGTGCTGCCCGAGCGCGGCGCGGTGGAGGTGCAG
CTCAGGATCGGCGCCCCGGACGCCGCCGGGCGCAGGCCGCTGGAGGCCCACGCCCGCGCC
GAGGGCGGCGCGTGGACCCGGCACGCCAGCGGCTCCCTCGCCGCCGACCGCTCCACCCCG
GTCCCGCTGACCGAGTGGCCGCCGACCGGCGCGCGCGAGGTCGACCTGGCCGGGTTCTAC
GACAGCCGGGCCGCCGAGGGCTACGACTACGGGCCCGCGCTGCGCGGGCTGCGACGGGCC
TGGACCCGCGACGGCGAGGTGTTCGCCGAGGTGGAGCTGCCCGCACCGCTGAGCCCGGAC
GGCTGGGGCCTGCACCCGGCCCTGTTCGACGCCGCGCTGCACGCCACCGGCCTGCTGCCC
CCGGCGCGGGTCGCCGCCGACGAGGTGCTGCTGCCGTTCTCCTGGCGGGGGACCAGGCTG
CGCGCCACCGGGGCGACCGCGCTGCGCGTGCGCCTGACCGGGACCGCCGACGACCACGTG
CTGCGCGCCTACGACCCCGAGGGCGCGCCGGTCGTGGAGGTCGACGCCCTGCGGCTGCGC
CCGGCCCCGGCCACCGCGCTCGTCGGCTCGGGCGCGCTGTTCCGCGTCGAGTGGGTCGAC
CTGGACTTGCCGGTGTCCACACCGGACTCCACGCCGGGCGCCCCCGTGCTCGACCGGCCC
GTGCTCGACCTGCCCGGCGGCGACGCCCGCACCCTCGTCGGCCTGACCCTGGAGGCCCTG
CGCGAGCACGACGAGCTGACCGTCGTCACGCGCGGCGCGGCCGAGGACCCGGCCGCCGCG
GCCGTGTGGGGGCTGCTGCGCACCGCCCAGACCGAGCGGCCGGGCCGCTTCGCCGTGGTC
GACCTGGACGACGACCCCGCCTCGCGCGCCCTGCTGCCCGCCCTGCCCGCCACCGGCGAA
CCGCAGGTCCGGGTGCGCGCGGGCAGGGCGAGCGCGCCGCGCCTGGCGCGCACCCGCGAC
GACGGCCTGCCGCTGCCCGCCGCCCCGACCTGGCGCCTGACCTGCGACGGCGGCACGTTC
ACCGACCTGGCCGCGACCCCGAGCCCGGCCGCGAACCGCCCGCTGGAACCCGGCGAGGTC
CGGGTGGGCGTGCGCGCCGCGGGCGTCAACTTCCGGGACGCCGCCGTCGTGCTGAACGCC
GTGCCCGGCCAGCGCGGGCTCGGCGGCGAGGCCGCGGGCGTGGTCCTGGAGACCGGCCCC
GGCGTCACCGGCCTCGCGGTCGGCGACCGGGGGCTCGGCACGTTCGACCGCGACTTCGGC
GCGTTCGGGCCGGTCGCGGTCACCGACGCCCGGCTGCTCGCGCCCGTCCCGCCCGGCTGG
GGGTTCGCGCGCGCCGCCTCGGTGCCGGTCGCGTTCCTCACCGCCCTCTACGGCCTGCGC
GACCTCGCCCAGGTCGGGCCGGGCGACCGCGTCCTGGTGCACGCGGGCGCGGGCGGCGTC
GGCGGCGCGGCCGTCAGGCTGGCCGCGCTGCTGGGCGCGGAGGTGTTCGCCACCGCGTCC
CCGGCGAAGTGGCCGGTGCTGCGCGCGCTCGGCCTGGACGACGCGCACCTGGCCTCCTCC
CGCGACACCGGGTTCGCCGAGCGCTTCCCGAACGTCGACGTCGTGCTGAACTCGCTCACC
GGCGAGCTGGTGGACGCCTCGCTGCGGCTGCTCGCGCCGGGCGGGCGGTTCCTGGAGCTG
GGCAAGGTCGACGTGCGCGACCTCGTGCGCGCCGACGTGACCTACCGGGCCTACGACCTG
CGCGACGCGGGCCCGGACCGCACCGCCGAACTGCTCGCCGAGGTGCTGGGGCTGTTCGCG
GCGGGCCGCCTTGAGCCGCTGCCGCTGACCGTCCGCGACGTCCGGCACGCCCCCGAGGCG
CTGCGGCACGTCGCGTCCGGCGGGCACGTCGGCAAGGTCGTGCTCACCGTCCCCCGCCCG
CTCGACCCCGAGGGCACCGTCCTGGTCCACGGCGGCGGCGCGCTCGGCGCGCTCACCGCC
CGCCACCTGGTGTCCGCGCACGGCGCCCGCCACCTGCTGATCACCTCCCGGCGCGGCCCC
GACGCGCCCGGCGCCGCCGAGCTGGCCGCCGACCTCGCCGAACTCGGCGCCACCACGCGG
TTCGAGCGCTGCGACGCCGCCGACCGCGACCGGGTCGCCGCCCTGCTGGCCGACCTGGGC
GGGCGCCCGCTGACCGCCGTCGTGCACACGGCGGGCGCGCTCGACGACGCCCTGCTCGCC
GACCAGGACGCGGCGCGCGTCGACGCGGTCCTGCGCCCCAAGCTCGACGGGGCGCTGCTG
CTGGACGAGCTGACCCGCGACGCCGACCTGGCCGCGTTCGTGCTGTTCTCCTCCGCCGCC
GGGACGCTCGGCAACGCGGGCCAGGCCAACTACGCCGCCGCGAACGCCGCGCTCGACGCG
CTGGCCGCCCGCCGCCGCTCCGCCGGGCTGCCCGCCACCTCCATCGCCTGGGGCCACTGG
GAGCACACCAGCGCCCTCACCGCCGGGCTCACCGCCGCCGACCTCGCGCGCGGGGCCAGG
CACGGCGCGGGCTCGCTCACCACCACCGAGGCGCTGGCCCTGCTCGACGCCGCGCTCGCC
TCGCCGGAACCCGCCGTCCTCGCCGCCGCGCTCGACCCCCGCCGCGCCGCCGAGGTCCCG
CCGCTGCTGCGCGACCTCGCCGGACCGCGCCGGGCGGTCGCGGCCCAGGCCGTCGCCGGC
GCGGACCGGCCGCTGATCGACGTGGTCAGGGCGCACACCGCGACCGTGCTCGGGCACCGC
GACGCCTCCGCCGTGGACGCGAACCGCGCGTTCAAGGAGCTGGGCGTCGACTCGCTCACG
GCCGTGGAGCTGCGCAACCGGCTCGCCGCCGCGACCGGGCTCGCGCTCGCCGCCACCTCG
GTGTTCGACCACCCGACCCCGGCGCTGCTCACCGCGCACCTGCTCGCCGAGCTCGGGCAC
GCCCCCGCCGCCGGGACCACCGCGCCCCCCGCCACCGCCGCCGTCACCGCCGACGCGGGG
GAGCCCATCGCGATCGTGTCGATGGCCTGCCGCTTCCCCGGCGACGTGTCCTCCCCGGAG
GACCTGTGGGACCTCGTCGCGGGCGGCGGGGACGCGCTCACCCCGTTCCCCGCCGACCGG
GGCTGGGACCTGGCGGCCCTGTTCGCCCCCGACCCGGACCGCGCCGGGCGCAGCCACGCC
CGCGAGGGCGGGTTCCTCGCCGACGTCGCGGGCTTCGACGCCGACCTGTTCGGCATCAGC
CCCCGCGAGGCCATCGGCACCGACCCGCAGCAGCGGCTGCTGCTGGAGGTGGCGTGGGAG
CTGTTCGAGCGCGCGGGCATCGCCCCCGACTCGCTGCGCGGCACCGACACCGGCGTGTTC
GCGGGCGTCATCGCGCACGGCTACCCGGTGCTGCCCGCCCACTCCGACCAGGGGCTGGAG
GGGCACCGGGTGACCGGGGTGTCCGGGAGCGTGGTGTCCGGCCGGGTCGCCTACGCCTTC
GGGCTGCAGGGACCGGCGATGACCGTGGACACCGCCTGCTCGTCGTCGCTGGTGGGCGTG
CACCTGGCGGTGCGGGCCCTGCGCGGCGGCGAGTGCTCGCTGGCGCTGGCGGGCGGCGTG
ACGGTGCTGAGCACGCCGGACCTGTTCGTGGACTTCTCCCGGCAGCGCGGGCTCGCCGCC
GACGGGCGCTGCAAGGCGTTCGGGGCGGGCGCGGACGGCACCGGGTTCGGCGAGGGCGTC
GGGCTGGTGCTGCTGGAGCGGCTGTGGGACGCGCGCCGCAACGGGCGCCGGGTGCTGGGG
CTGGTGCGCGGCAGCGCGGTGAACTCCGACGGGGCCTCCAACGGGCTGACCGCGCCCAGC
GGCCCCGCGCAGGAGCGCGTCATCGGGCGGGCGCTCGCGGACGCCGGGCTGTCGGCGGCC
GACGTGGACCTCGTGGAGGCGCACGGGACCGGGACCCGGTTGGGCGACCCGATCGAGGCG
CGGGCGCTGGTGGCGACCTACGGGCGGGACCGGGGCGGGGAGCCGGTGTGGCTCGGGTCG
GTCAAGTCCAACATCGGGCACACCCAGGCCGCCGCCGGGGTCGCCGGGCTGATCAAGGCG
GTGCAGGCGCTGCGGCACGGGGTGCTGCCCGCGACCCTGCACGCGGCCGAGCCCACCCCC
GAGGTCGAGTGGGACGGGGTCGCGGTGCTGGCCGAGCAGCGGGACTGGCCCGAGGTGGGC
AGGCCGCGCCGGGCGGCGGTGTCCTCGTTCGGGGTCAGCGGCACCAACGCGCACGTGGTG
CTGGAGCAGGCGCCCGAGGAGTTGAGCCCCGAGGGGCGGATCCCCGAGGTGCGGATCCCC
GACAGGCGGACTTCAGAGGGGCGGGTGCCTGAGGGGCGGGCGCCCGAGGGACGGACGTCC
GGAGGCCGGGCACCCGAGGGCCAGACATCCGAGGGCCGGGCGTTCGGCGGCCGGGTGCCC
GAAGACCAGACATCCGAAGACCGGACATCCGAGGGCCAGGCGTCCATGGGGCGGGCGCCT
GAGGGCCAGGCGCCCCTGGGCCAGGTGTCCGAGAGCCGGGCGCCCGACCACCGGGTGCCC
GCCGGGCCCGACCGGGACGTCCCCGGTCACCTGCCGCTCGTGCTGTCCGCGCACGACCCG
GCCGCGCTGCGCGCCACCGCGGCCCGCCTGCTGCCGGTCGCCGAGCGCGTCCCGCTGCCC
GATCTGGCGCTGTCCCTGGTCACCGGCCGCGCCGCCCTGCCCTGCCGGGCGGTGATCCCC
GCCCGCGACCGGGGTCAGGCGCTGGCGGCGCTGCGCGACCTCGCGTCCGGCGCCACCGCG
CCCGCCGAGCGGGACGGCGGGGGCGTGGCGTTCCTGCTGTCCGGCCAGGGCAGTCAGCGG
GCCGGGACCGGGCGGCTGCTGGAGCGGCGGTTCCCGGTGTTCCGGGACGCGCTGCGCGAG
GTGTGCGCCCTGCTGGACCGGCGCGTCGTCGGCGGTCCCGGCGTGCGCGCCGCGCTGGAC
GACCCCGGGCTGCTCGCCGACACCCGCTACGCGCAGGCCGGCCTGTTCGCCGTGCAGGTC
GCGCTGGTGCGCCTGCTCGACGCGCTCGGCGTCCGCCCCGACCTGCTCGCCGGGCACTCG
GTCGGCGAGATCGCCGTCGCGCACGCCGCCGGGGTGCTGTCCCTGGAGGACGCCTCCACC
CTCGTGGCCGCGCGCGGCGCCCTCATGCGCGAGCTGCCCCCCGGCGTGATGGTCGCGGTC
CGCGCGGGCGAGGACGAGGCGCGCGCCGCGCTGGTCGACGGGGTGGAGCTGGCCGCCGTC
AACGGCCCCCGCGCCACCGTGCTCACCGGCGACGAGGCCGCCGTCACCGAGGTCGCCGCC
CGCCTCGGGCGCGCCACGCGCCTGCGGGTCGCCCACGCCTTCCACTCGGCCGCCGTCGAC
GCGGTGCTGCCCGCGTTCGCCGACGTGCTGGCGCGCCTGGACTTCCGCCCGCCGCGCGTC
CCGGTGGCCACCACCGCGCCCGGCGCGCTCGACGCGCCCGAGTACTGGCTGGGCCAGGCC
CGCGAGCCGGTGCGCTTCGCCGACGCCGTCACCGACCTGCACCGGCGGGGCGCGACCGCG
TTCGTCGAGGTCGGCCCCGGTGGTGGGCTGGCCGCCGCCGCGCAGGAGTGCCTGGACGGG
CACGACGTGCTCTGCGCCCCCCTGCTGCACCGCGACCGGGACGAGGACCACTCCCTGATC
ACCGCGCTCGGCGCGCTGCACGCGAGGGGCGCGCGCGTCGACTTCGCCCCGCTGCTGGCC
GACGCGGGCGGCCGGACCACCGACCTGCCCACCTACCCGTTCCAGCGCCGCCGCTTCTGG
CTCGACCCCGCCCCGCCCACCACCGACGCCGCCCCGCTGGAGCACCCGCTGCTCACCGGG
GAGCTGGAGATCCCCGGCTCGGACACCGCCGCGTTCACCGGCCGCGCCGCCACCGGCGCC
CACCCGTGGCTGGCCGACCACCGGCTGCTCGACGCGGTCGTCGTGCCCGGCACGGCCCTG
CTGGACCTGGTGCGGGCGGCCGGTCGCCAGCTCGGGCTGCCCGAGGTCGCCGAGCTGGTC
AACGAGGTCCCGCTGGTGCTCGGCGACGGGGCGGCGCTGCTGCGCGTCACCGCCGCCGCG
CCGGGACCGGACGGGCGGCGGGAGGTGGCCGTGCACTCCCGGCCGGAGTCGGCAGGGCCG
CGCTCACCGTGGACCCGGCACGTCACCGGCCAGCTCGCCCCCGAGTCGGGGCCGCTCGCG
TTCGACCTGGCGCAGTGGCCGCCGCCGGGCGCGCTGCCGCTGCCGGTGGCCGACCACCGG
GCCGCGATGGCCGCCACCGGCCACGGGTACGGGCCCGCGTTCCTGGGGCTGCGCGCCGCC
TGGAAGCTCGACGACGAGGTGCTGGTGGAGGCGGTCCTGCCGGACGAGGTCGCCGACGAC
GGGCACGCCGTGCACCCCGCGCTGCTCGACGCGGTGCTCCAGGCCATCGCGCTCACCGGC
GTCGAGGACGGCTCGCAGGTGCGGGTGCCGTTCAGCTGGCGCTCCGCGCGCGGCGCGGGC
CGGGCGGGCCGCGCGGTGCGCGCCTCCCTGCGGCCCGACGGCGACGGCGGCGTCCGGGTG
CGCGTGGCCTGCCCGCGGGGCCGCCCGCTGCTGGAGATCGCCTCGCTGGTGTCCCGGCCG
GTCACCCCCGACCGGCTGCGGCCGGGGGTGCTGCTGCGCCAGGCGTGGACGGAGGTCGGC
CCGCCGCCCGGCGCCGCCGAGCCCGTGCCGCTGCGCGAGGTCGGCGAGCGGGTGCCGCCG
GTGGTGCGGGTCGACGCCGGGCACGTCCGCGACCTGCTGCCGCTGCTCCAGGAGGTGGTG
ACCGAGCCCCGCTGGGAGTCGACGCGGCTGCTCGTGACGACCTCGGGCGCGGTGGGGCCG
CGCGCCGGACGCGCCGAGGGCGCCGCGGTGTGGGGCCTGGTGCGGTCGGCCGCCGCCGAG
CACCCAGGCCGGTTCGTCCTGGCCGACCTGGACGACCGGCCCGAGTCCGCCGCGCTGCTG
CCCGCCCTCGCCACCGGCGCGCTGCCGGAGGCGGTGCTGCGCGCGGGACGCGTGCTCGTG
CCGGGGCTGCACCGGGTCTCCGCGCCCGGCGCAGGCGGGGCCGTGCTCGACCCCGGCGGC
GCCGCGCTGATCACCGGCGGTTCCGGCGCGCTGGCCGCGCTGCTGGCCGAGCACCTGGTG
CGCGCGCACGGCGTGCGCTGCCTGGTGCTGCTCAGCCGCAGCGGGCGCGGACCGGACGTG
CCGGGCGCCGACGTGCGGCACGTGCGCGGCGACGTCGCGAACCGGGCCGACGTGGTCGCG
GCGCTGGCCGCCGTGCCGCCGGACCGGCCGCTGACGCTGGTGGCGCACCTGGCCGGGGTG
CTCGACGACGGCGCCCTGACCGCGCTGACCCCCGAGCGGCTGGACGCGGTGCTGCGCCCC
AAGGCCGAGGGCGCCCGGCACCTGGACGAGCTGACCAGGGACCGGGACCTGGCGGCGTTC
GTGCTGTTCTCCTCGGTCGCGGGCGCGCTCGGCCACGCCGGGCAGGCCAACTACGCGGCG
GCCAACGCCCACCTGGACGGCCTCGCGCACGAGCGGCACGCCCTCGGCCTGCCCGCCACG
GCGCTGGCCTGGGGGCCGTGGACCGAGGGCATGGCGCGCGGTCGCGGAACGCTCTCGCCG
CAGGTCGCGCTCGGCCTGTTCGACGCGGCCCTGCGCACCGGTCTGCCCGCGCTCGTCCCG
CTCGACCGCGAACCGGAGCGCCGGGTCCCCGCCCCGCGCGCCGCGACCCCCGCCCCGGCC
GGGCCGTCGCTGGCCGACCGGCTGCGCCCGATGCCGCCCGCCGAGCGGCGCGCCCACCTG
CTGGAGCTGGTCACCGCCGAGGCGCTGGGCGTGCTGGGCCACGACGACGGGGCCGCGCTG
CCCGCCGGGCAGGCGTTCCGCGACGCCGGGTTCGACTCGATCACCGCGATGGCGCTGCGC
AACCGGCTCGTCCGGCTGGCCGGGGTGCGGCTGCCCGCGAGCGTGGTGTTCGACCACCCC
ACCCCGGCCGCCACCGCCGAGCGCCTGGAGGCCGAGCTGTTCCCGGCCGACCGGCTGCCG
GGGCCCCGGCACGGCGACGACTTCGACGACATGGCCGCCGACGAGCTGGTCCGCCGCGCA
CTCGGCGGCGAGTAG
[0] A35..434
[0] PCP921..994
[1] KS1020..1386
[1] AT1535..1839
[1] methylmalonyl-CoA1713..1717
[1] DH1879..2037
[1] ER2298..2595
[1] KR2605..2783
[1] ACP2865..2935
[2] KS2961..3335
[2] AT3571..3873
[2] malonyl-CoA3752..3756
[2] DH3915..4077
[2] KR4340..4510
[2] ACP4577..4650
[0] A103..1302
[0] PCP2761..2982
[1] KS3058..4158
[1] AT4603..5517
[1] methylmalonyl-CoA5137..5151
[1] DH5635..6111
[1] ER6892..7785
[1] KR7813..8349
[1] ACP8593..8805
[2] KS8881..10005
[2] AT10711..11619
[2] malonyl-CoA11254..11268
[2] DH11743..12231
[2] KR13018..13530
[2] ACP13729..13950

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [35-434]  1.10000000000001e-104 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1528-1654]  G3DSA:3.40.366.10 [1713-1829]  G3DSA:3.40.366.10 [3565-3692]  G3DSA:3.40.366.10 [3752-3862]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2605-2770]  3.89999999999997e-53 PF00106 [4340-4497]  1.29999999999998e-46 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [2893-2908]  PS00012 [4608-4623]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [918-1036]  1.99999636034521e-18 SSF47336 [2858-2977]  6.79998707392904e-25 SSF47336 [4571-4657]  1e-18 SSF47336
SSF47336   ACP_like
 [921-994]  PS50075 [2865-2935]  PS50075 [4577-4650]  PS50075
PS50075   ACP_DOMAIN
 [946-997]  8.30000000000004e-50 G3DSA:1.10.1200.10 [2865-2939]  8.30000000000004e-50 G3DSA:1.10.1200.10 [4579-4653]  8.30000000000004e-50 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [924-993]  1e-05 PF00550 [2868-2934]  3.8e-11 PF00550 [4586-4649]  7.1e-07 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [2313-2437]  7.69998480533694e-24 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2317-2371]  1.4e-05 PF08240
PF08240   ADH_N
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1020-1261]  8.19999999999987e-85 PF00109 [2961-3211]  5.90000000000008e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1269-1386]  7.59999999999998e-47 PF02801 [3220-3335]  9.69999999999989e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1535-1839]  8.19999999999987e-92 PF00698 [3571-3873]  1.29999999999998e-52 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1533-1811]  3.89999861795218e-67 SSF52151 [3568-3856]  2.30000440726534e-56 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1656-1712]  3.1999989904635e-13 SSF55048 [3693-3751]  2.89999717862184e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [1022-1273]  G3DSA:3.40.47.10 [1274-1437]  G3DSA:3.40.47.10 [2961-3221]  G3DSA:3.40.47.10 [3223-3387]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1012-1436]  2.39999798157263e-96 SSF53901 [2953-3386]  3.10001307370203e-96 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2392-2570]  9.40000000000003e-46 G3DSA:3.40.50.720 [2606-2806]  1.29999999999998e-59 G3DSA:3.40.50.720 [4339-4527]  1.29999999999998e-59 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1174-1190]  PS00606 [3124-3140]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1537-1820]  8.39998014024973e-110 SM00827 [3572-3853]  1.39999277195148e-87 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [926-997]  1.20000117458134e-19 SM00823 [2866-2938]  3.80000697093588e-33 SM00823 [4581-4653]  1.10000150671642e-24 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1879-2037]  1.39999277195148e-71 SM00826 [3915-4077]  7.0999832511256e-58 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [1022-1436]  SM00825 [2963-3386]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2605-2783]  4.79998722798115e-51 SM00822 [4340-4510]  8.39998014024981e-50 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2298-2595]  SM00829
SM00829   PKS_ER
IPR020845 AMP-binding, conserved site (Conserved_site)
 [162-173]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [472-498]  5e-05 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit