close all open/close all

CDS information : Ansam_00290


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction69,084 / 70,292 / + [in whole cluster]
13,663 / 12,455 / - [in contig]
Location69084..70292 [in whole cluster]
complement(12455..13663) [in contig]
TypeCDS
Length1,209 bp (402 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductUDP-glucose N-glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)asm25
EC number
Keyword
  • derivative
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[18721757] Amide N-glycosylation by Asm25, an N-glycosyltransferase of ansamitocins. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>UDP-glucose N-glycosyltransferase [glycosyltransferase]
MRVLFTVTGAPSHAHEMLVLGRAVLDAGHEVLVATAPSAAPGLRGSGLPSVEALPDQARF
WVERLGGVAPPARPGTDYPGVAAIVDVIAGRPLLREALTGLRPVVDRFRPDLVLRDGMEL
AGLLVAEERGLPCLTVPSGTTNQLDPAAVLPRLNERRAEQGLPTSADPLGAHRHGHVDCL
PREYSLLGVPLSPCLAYRPPSPDGRSLPAWVADLDPSRPLVYGAVGIALAALWRRDDVTA
LVADPVEALGGLVAALSEVDCAAVVSTGGIPVDRVPPGAPHVRVVERAPQPLLLECAQLF
VTHAGANSVREAVRAGVPMVAAPLFGDQPHNAARVAALGLGVRVVDGSPADLADACRTVL
ADPRFTARARHARRTLLALPPVGEVVTRLEQIADAARSVAVV
selected fasta
>UDP-glucose N-glycosyltransferase [glycosyltransferase]
TTGCGCGTTCTGTTCACCGTCACCGGGGCCCCGTCGCACGCGCACGAGATGCTCGTGCTC
GGGCGCGCGGTCCTGGACGCCGGGCACGAGGTGCTCGTGGCCACGGCCCCCAGCGCCGCG
CCCGGCCTGCGGGGCAGCGGCCTGCCCTCGGTCGAGGCGTTGCCCGACCAGGCGAGGTTC
TGGGTGGAGCGGCTCGGGGGCGTCGCGCCACCGGCCAGGCCGGGCACGGACTACCCCGGC
GTCGCCGCGATCGTCGACGTCATCGCGGGCAGGCCGCTGCTGCGGGAGGCGCTGACCGGG
CTGCGCCCCGTCGTCGACCGCTTCCGGCCCGACCTGGTCCTGCGCGACGGCATGGAGCTG
GCCGGCCTGCTCGTCGCGGAGGAGCGCGGGCTGCCCTGCCTGACCGTGCCCTCGGGCACG
ACGAACCAGCTGGACCCGGCCGCCGTGCTGCCCCGGCTCAACGAGCGCCGCGCCGAGCAG
GGCCTGCCCACCTCGGCCGACCCGCTCGGCGCGCACCGGCACGGCCACGTCGACTGCCTG
CCGCGCGAGTACTCGCTGCTCGGCGTCCCGCTCAGCCCGTGCCTGGCCTACCGGCCGCCG
TCGCCCGACGGCCGGTCGCTGCCCGCGTGGGTGGCCGACCTGGACCCGTCCCGCCCGCTG
GTGTACGGGGCGGTCGGCATCGCGCTGGCCGCCCTGTGGCGCCGCGACGACGTGACCGCG
CTGGTCGCCGACCCGGTGGAGGCGCTGGGCGGACTCGTGGCGGCCCTGTCCGAGGTGGAC
TGCGCCGCGGTGGTGTCCACCGGGGGCATCCCGGTCGACCGCGTCCCGCCGGGCGCGCCG
CACGTGCGCGTGGTCGAGCGGGCGCCCCAGCCGCTGCTGCTGGAGTGCGCGCAGCTGTTC
GTCACCCACGCCGGGGCCAACAGCGTGCGCGAGGCGGTGCGGGCGGGGGTGCCCATGGTC
GCCGCCCCGCTGTTCGGCGACCAGCCGCACAACGCCGCCAGGGTCGCCGCGCTGGGGCTG
GGCGTGCGGGTGGTGGACGGCTCGCCCGCCGATCTGGCGGACGCCTGCCGGACCGTGCTG
GCCGATCCCCGCTTCACCGCGAGGGCGCGCCACGCGCGCCGGACCCTGCTCGCGCTGCCC
CCGGTGGGCGAGGTGGTGACCCGCCTGGAGCAGATCGCCGACGCCGCGCGGAGCGTCGCG
GTGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [282-365]  6.40000000000001e-19 PF00201
PF00201   UDPGT
SignalP
 [1-14]  0.689 Signal
Eukaryota   
 [1-14]  0.33 Signal
Bacteria, Gram-negative   
TMHMM No significant hit