close all open/close all

CDS information : Ansam_00310


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction70,810 / 71,835 / + [in whole cluster]
11,937 / 10,912 / - [in contig]
Location70810..71835 [in whole cluster]
complement(10912..11937) [in contig]
TypeCDS
Length1,026 bp (341 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)glucose 1-dehydrogenase
Gene
Gene (GenBank)asm27
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [glucose 1-dehydrogenase]
MPRRLAEQVVVVVGASSGIGRVTALRFAAAGARVVCAARNTRALDGLVEEVRGAGGRAVA
VTADIADEAAVRAVADVAVERFGRVDTWVNAAGIGVYGRVEDTPAGEFDRVMRVNYLGHV
HGAKAALPALRRAGGGVLIGVASVLGLRSAPLQAPYAASKAAVRAFYDALRVELAHDGES
IAVTAVLPAAINSPFFEHCRSRVGSLPKPPPPVYAPELVAEAVLRAAERPRREVPVGDAA
LAFYLGQRLFPALTDALMSVRAVGRSGMRSELPDNGVDNVDSPVDEDGRVHGSYPGRVLD
SSPVTALLARVPRPGELATSLVSGAHRVGGAVRGGLRAARS
selected fasta
>putative oxidoreductase [glucose 1-dehydrogenase]
ATGCCCAGGAGGTTGGCGGAGCAGGTCGTCGTCGTGGTGGGCGCGTCGTCGGGGATCGGG
CGGGTCACCGCGCTGCGGTTCGCGGCGGCGGGGGCGCGCGTGGTGTGCGCGGCGCGCAAC
ACCCGCGCCCTGGACGGGCTGGTCGAGGAGGTCCGGGGCGCGGGTGGGCGGGCGGTCGCG
GTGACGGCGGACATCGCCGACGAGGCGGCCGTGCGCGCGGTCGCCGACGTGGCGGTGGAG
CGGTTCGGGCGGGTGGACACCTGGGTCAACGCGGCCGGGATCGGGGTGTACGGGCGGGTG
GAGGACACGCCCGCCGGGGAGTTCGACCGGGTGATGCGGGTCAACTACCTCGGGCACGTG
CACGGGGCCAAGGCCGCGCTGCCCGCGCTGCGCCGGGCGGGCGGGGGAGTGCTGATCGGG
GTCGCGTCCGTGCTCGGCCTGCGCTCGGCTCCGCTCCAGGCCCCGTACGCGGCCAGCAAG
GCGGCGGTGCGGGCGTTCTACGACGCGCTGCGGGTGGAGCTGGCCCACGACGGCGAGTCG
ATCGCGGTCACCGCCGTGCTTCCCGCCGCGATCAACAGCCCGTTCTTCGAGCACTGCCGC
AGCCGCGTCGGCTCGCTGCCCAAGCCGCCGCCCCCGGTGTACGCGCCGGAGCTGGTCGCC
GAGGCCGTGCTGCGCGCCGCCGAGCGCCCCCGCCGCGAGGTGCCGGTGGGCGACGCTGCG
CTCGCGTTCTACCTGGGGCAGCGGCTGTTCCCGGCGCTCACCGACGCGCTGATGTCGGTG
CGCGCGGTCGGCCGGTCGGGGATGCGGTCCGAGCTGCCGGACAACGGGGTGGACAACGTG
GACTCGCCGGTGGACGAGGACGGGCGGGTGCACGGGTCCTACCCCGGCCGGGTGCTGGAC
TCCAGCCCGGTGACGGCGCTGCTGGCCCGCGTGCCCAGGCCGGGGGAGCTGGCGACCTCG
CTGGTGAGCGGGGCGCACCGGGTGGGCGGGGCGGTGCGGGGCGGGCTGCGCGCGGCCCGG
TCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [9-174]  1.8e-30 PF00106
PF00106   adh_short
 [83-94]  2.6999988713206e-08 PR00080 [136-144]  2.6999988713206e-08 PR00080 [156-175]  2.6999988713206e-08 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  3.69999438558106e-20 PR00081 [83-94]  3.69999438558106e-20 PR00081 [130-146]  3.69999438558106e-20 PR00081 [156-175]  3.69999438558106e-20 PR00081 [179-196]  3.69999438558106e-20 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [8-252]  6.6999999999999e-63 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [143-171]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-28]  0.803 Signal
Bacteria, Gram-positive   
 [1-24]  0.83 Signal
Eukaryota   
TMHMM No significant hit