close all open/close all

CDS information : Ansam_00320


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction72,354 / 71,890 / - [in whole cluster]
10,393 / 10,857 / + [in contig]
Locationcomplement(71890..72354) [in whole cluster]
10393..10857 [in contig]
TypeCDS
Length465 bp (154 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)asm28
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTDTTTRHRTPVQNAALAVGAVFLLVGIAGFVPGLTTNYDGLEFAGHHSDAALLGVFKVS
ALHNLVHLAFGAAGIAAGLSKAPRGARAFLIGGGAIYAVLWLYGVVVDEHSTANFVPLNA
ADNWLHLGLAVGMIGLGAALGRNAAHYRAARSDD
selected fasta
>hypothetical protein [unknown]
ATGACCGACACGACGACGCGCCACCGCACGCCGGTGCAGAACGCCGCTTTAGCGGTGGGC
GCGGTGTTCCTGCTGGTGGGCATCGCCGGGTTCGTCCCCGGCCTGACCACGAACTACGAC
GGCCTGGAGTTCGCGGGCCACCACTCGGACGCCGCCCTGCTGGGCGTGTTCAAGGTCTCC
GCGCTGCACAACCTGGTGCACCTCGCGTTCGGCGCGGCGGGCATCGCCGCGGGGCTGTCC
AAGGCCCCGCGCGGGGCCCGCGCGTTCCTGATCGGCGGCGGCGCGATCTACGCGGTGCTG
TGGCTGTACGGCGTGGTCGTGGACGAGCACAGCACGGCCAACTTCGTGCCGCTCAACGCC
GCCGACAACTGGCTGCACCTCGGCCTGGCCGTCGGCATGATCGGCCTCGGCGCGGCGCTG
GGCCGCAACGCGGCGCACTACCGCGCGGCGCGGTCCGACGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025492 Protein of unknown function DUF4383 (Family)
 [12-138]  5.10000000000004e-42 PF14325
PF14325   DUF4383
SignalP
 [1-34]  0.546 Signal
Bacteria, Gram-positive   
 [1-30]  0.576 Signal
Eukaryota   
TMHMM
 [12-34]  Transmembrane (i-o) [54-76]  Transmembrane (o-i) [88-107]  Transmembrane (i-o) [122-141]  Transmembrane (o-i)
Transmembrane 4