close all open/close all

CDS information : Ansam_00330


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction73,083 / 72,502 / - [in whole cluster]
9,664 / 10,245 / + [in contig]
Locationcomplement(72502..73083) [in whole cluster]
9664..10245 [in contig]
TypeCDS
Length582 bp (193 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)asm29
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[19609582] Constitutive overexpression of asm2 and asm39 increases AP-3 production in the actinomycete Actinosynnema pretiosum. (J Ind Microbiol Biotechnol. , 2009)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
MSAAVRREQLVAAALRVMKRDGIAAATTRAICAEADMPHGAFHYCFRSKQELYTALLTTG
LNTSLDAAWPAISPDLPAVDNVRTMLAAFWTAFQADPEAELVLGELVTLAQREPELRELP
AWQHREYVAKAVAHLDRLAEEAGFDYSVDRALLAELVVSVLDGVASSWFSHRDGELAKAS
LDQFAVMFAALTR
selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
GTGAGCGCGGCCGTGCGGCGCGAGCAGCTCGTGGCCGCCGCGCTGCGCGTGATGAAGCGC
GACGGGATCGCCGCGGCGACCACGCGCGCGATCTGCGCCGAGGCCGACATGCCGCACGGC
GCGTTCCACTACTGCTTCCGCTCCAAGCAGGAGCTGTACACCGCGCTGCTCACCACGGGC
CTGAACACCAGCCTGGACGCGGCGTGGCCCGCGATCTCGCCGGACCTGCCCGCCGTGGAC
AACGTCCGCACGATGCTGGCCGCCTTCTGGACCGCGTTCCAGGCCGACCCGGAGGCGGAG
CTGGTGCTGGGCGAGCTGGTCACCCTCGCCCAGCGGGAGCCCGAGCTGCGCGAGCTGCCC
GCGTGGCAGCACCGCGAGTACGTCGCCAAGGCGGTCGCGCACCTGGACCGGCTCGCCGAG
GAGGCCGGGTTCGACTACTCGGTGGACCGGGCGCTGCTGGCGGAGCTGGTGGTGTCGGTG
CTGGACGGGGTCGCCTCGTCCTGGTTCTCGCACCGGGACGGGGAGCTGGCGAAGGCGTCG
CTGGACCAGTTCGCCGTGATGTTCGCGGCCCTGACGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [4-64]  PS50977
PS50977   HTH_TETR_2
 [10-56]  7e-12 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [2-80]  4.79999776836274e-15 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [76-193]  2.70000183580794e-10 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [5-187]  6.19999999999995e-33 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP
 [1-24]  0.439 Signal
Bacteria, Gram-positive   
TMHMM No significant hit