close all open/close all

CDS information : Ansam_00340


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction73,229 / 76,246 / + [in whole cluster]
9,518 / 6,501 / - [in contig]
Location73229..76246 [in whole cluster]
complement(6501..9518) [in contig]
TypeCDS
Length3,018 bp (1,005 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative bifunctional cytochrome P450/NADPH--cytochrome P450 reductase
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)asm30
EC number
Keyword
Note
Note (GenBank)
  • bifunctional protein
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)
Related Reference
ACC
P14779
PmId
[2544578] Coding nucleotide, 5' regulatory, and deduced amino acid sequences of P-450BM-3, a single peptide cytochrome P-450:NADPH-P-450 reductase from Bacillus megaterium. (J Biol Chem. , 1989)
[1727637] Fatty acid monooxygenation by P450BM-3: product identification and proposed mechanisms for the sequential hydroxylation reactions. (Arch Biochem Biophys. , 1992)

close this sectionSequence

selected fasta
>putative bifunctional cytochrome P450/NADPH--cytochrome P450 reductase [cytochrome P450]
MVATGTRIPGPKPLPLVGNLLDVLTSDLDTDVDFLDRCHREHGGIVALTFAGQRQVFASS
HELVARMCSDPSWGKAVHPALEQVRDFAGDGLFTARGDEPNWGKAHRLLMPAFGPTAMRD
HFPAMLDIAEQMLVRWRRFGPDHRIDVADDMTRLTLDTIALCAFGARFNSFYRDRAHPFV
DAMVRSLVEAGERAERLPGVQPFLVGRNQRYRDDIATMNRIADGIVAARAALPAGERPDD
LLERMLTCADPVTGERLSARNVRYQLATFLIAGHETTSGLLSFAVHRLLAHPEVLRKAKD
AVDGVLGDRVPAFEDLARLDYLGQVLRETLRLHPTAPAFALAPDEPAELGGHAIGAGEPV
LVMLPTLHRDPAVWRDPDVFDPERFAPERMDEIPACAWMPFGHGARACIGRPFALQEATL
VLALVLQRFDLALADPDHRLTIKQTLTLKPDSLVVRARPRADRPGATATVETVVPHQVPA
THRHGTPLHVFYGSNGGSGEGLARTIAGDGAARGWATSVAPLDDAVRALPASGPVVIVSS
SYNGAPPDNAAHFVRWLTQDGPDLSGVDYLVLGCGNLDWSATYQRVPTLIDEAMAAAGAR
RLRERGATDARADFFGDWERWYEPLWPLLSAECGVEVGEIGPRFRVVESDAADGLGDLAS
AVVLENRELVRGPDAGSKRHLELRLPDGTSYRTGDYLSVLPQNHPDLVRRAVARLGTRAE
RVVTVESSAPTGLVPVGRALRVDELLTRCVDLSAPAGAGVVARLAERCPCPPERAELAAT
TGATLLELLERFPSCAVDLALALELLPAPRTRLYSISSAAEEQRAEVALTVSVTGVTSGY
LSRVRPGDRVAVGIASPPESFRPPADNTVPVVLIAAGTGIAPFRGFLRARAALGGEPGPA
LLLFGCRGPELDDLYAEEFAALGDWLEVDRAYSRHPDGEVRHVQHRLWQRRDRVRELVDA
GARVYLCGDATRVGPAVEEVLGRIGPGAGWLDALRAGGRYATDVF
selected fasta
>putative bifunctional cytochrome P450/NADPH--cytochrome P450 reductase [cytochrome P450]
GTGGTCGCCACCGGCACGCGCATCCCCGGCCCCAAGCCCCTGCCCCTGGTGGGGAACCTG
CTCGACGTCCTCACCTCCGACCTGGACACCGACGTCGACTTCCTCGACCGCTGCCACCGC
GAGCACGGCGGCATCGTCGCGCTGACCTTCGCCGGGCAGCGCCAGGTCTTCGCCTCCAGC
CACGAGCTCGTCGCCCGCATGTGCTCCGACCCGAGCTGGGGCAAGGCCGTGCACCCCGCG
CTGGAGCAGGTCCGCGACTTCGCGGGCGACGGGCTGTTCACCGCGCGCGGCGACGAGCCG
AACTGGGGCAAGGCGCACCGGCTGCTCATGCCCGCCTTCGGCCCCACCGCCATGAGGGAC
CACTTCCCGGCCATGCTCGACATCGCCGAGCAGATGCTCGTGCGCTGGCGGCGGTTCGGC
CCCGACCACCGCATCGACGTCGCCGACGACATGACCCGGCTGACCCTGGACACCATCGCG
CTGTGCGCCTTCGGCGCCCGGTTCAACTCCTTCTACCGCGACCGGGCCCACCCCTTCGTC
GACGCGATGGTCCGCAGCCTCGTGGAGGCGGGCGAGCGCGCCGAGCGGCTGCCGGGCGTG
CAGCCGTTCCTGGTGGGCAGGAACCAGCGGTACCGCGACGACATCGCCACCATGAACCGG
ATCGCCGACGGGATCGTCGCCGCGCGCGCCGCACTGCCCGCAGGGGAGCGGCCGGACGAC
CTGCTGGAGCGGATGCTCACCTGCGCCGACCCGGTCACCGGGGAGCGGCTGTCCGCGCGG
AACGTGCGCTACCAGCTGGCCACGTTCCTGATCGCCGGGCACGAGACCACCTCCGGCCTG
CTCTCCTTCGCCGTGCACCGGCTGCTGGCGCACCCCGAGGTGCTGCGCAAGGCCAAGGAC
GCGGTGGACGGGGTCCTGGGCGACCGCGTGCCCGCGTTCGAGGACCTGGCCCGGCTCGAC
TACCTCGGGCAGGTGCTGCGCGAGACCCTGCGGCTGCACCCGACCGCGCCCGCGTTCGCC
CTGGCCCCCGACGAGCCCGCAGAGCTGGGCGGCCACGCGATCGGCGCGGGCGAGCCGGTG
CTGGTGATGCTGCCGACGCTGCACCGGGACCCGGCGGTGTGGCGCGACCCCGACGTGTTC
GACCCGGAGCGGTTCGCGCCCGAGCGGATGGACGAGATCCCGGCCTGCGCGTGGATGCCG
TTCGGGCACGGGGCGCGGGCGTGCATCGGGCGGCCGTTCGCCCTGCAGGAGGCGACCCTC
GTGCTGGCGCTGGTGCTCCAGCGGTTCGACCTCGCGCTCGCCGACCCCGACCACCGGCTG
ACGATCAAGCAGACGTTGACCCTCAAGCCGGACTCGCTGGTGGTCCGCGCCCGGCCGCGC
GCCGACCGCCCTGGCGCCACCGCGACCGTCGAAACCGTTGTGCCGCACCAGGTTCCGGCC
ACCCATCGGCACGGAACCCCGCTGCACGTGTTCTACGGGTCGAACGGCGGCAGCGGCGAG
GGCCTGGCGCGCACGATCGCCGGTGACGGTGCGGCTCGCGGGTGGGCGACTTCCGTCGCG
CCCCTTGACGACGCGGTGCGCGCCCTGCCCGCGTCGGGACCGGTGGTGATCGTCAGCTCC
TCCTACAACGGCGCCCCGCCGGACAACGCGGCCCACTTCGTGCGGTGGCTCACGCAGGAC
GGGCCCGACCTGTCCGGAGTGGACTACCTGGTGCTCGGCTGCGGCAACCTGGACTGGTCG
GCCACCTACCAGCGCGTGCCCACCCTGATCGACGAGGCCATGGCGGCGGCGGGCGCCCGG
CGGCTGCGCGAGCGCGGGGCCACCGACGCCCGCGCGGACTTCTTCGGCGACTGGGAGCGC
TGGTACGAGCCGCTGTGGCCGCTGCTGTCGGCCGAGTGCGGGGTCGAGGTGGGCGAGATC
GGGCCGCGCTTCCGGGTGGTCGAGTCGGACGCGGCCGACGGCCTCGGCGATCTCGCGTCG
GCGGTCGTGCTGGAGAACCGGGAGCTGGTGCGCGGACCGGACGCCGGGTCCAAGCGGCAC
CTGGAGCTGCGGCTGCCCGACGGCACGTCCTACCGCACCGGCGACTACCTGTCCGTGCTG
CCGCAGAACCACCCCGACCTGGTGCGGCGGGCGGTGGCGCGGCTGGGCACGCGCGCGGAG
CGGGTCGTGACGGTCGAGTCGAGCGCGCCCACCGGGCTGGTGCCGGTCGGGCGCGCGCTG
CGCGTGGACGAGCTGCTGACCCGGTGCGTCGACCTGTCCGCGCCCGCGGGCGCCGGGGTC
GTCGCGCGCCTGGCCGAGCGCTGCCCCTGCCCGCCGGAGCGCGCCGAGCTGGCCGCCACG
ACCGGGGCGACGCTGCTGGAGCTGCTGGAGCGCTTCCCCTCGTGCGCGGTCGACCTGGCG
CTGGCCCTGGAACTGCTGCCCGCGCCCAGGACCCGCCTGTACTCGATCAGCTCGGCGGCC
GAGGAGCAGCGGGCCGAGGTGGCGCTCACCGTGTCGGTCACCGGCGTGACCTCCGGCTAC
CTGAGCCGGGTGCGACCCGGCGACCGCGTGGCCGTCGGGATCGCGTCACCGCCGGAGTCG
TTCCGCCCGCCCGCCGACAACACCGTCCCCGTGGTGCTGATCGCCGCGGGCACCGGGATC
GCGCCGTTCCGGGGGTTCCTGCGGGCGCGGGCCGCGCTCGGCGGCGAACCGGGCCCGGCG
CTGCTGCTGTTCGGCTGCCGGGGGCCCGAGCTGGACGACCTGTACGCGGAGGAGTTCGCC
GCGCTCGGCGACTGGCTGGAGGTGGACCGGGCCTACTCGCGCCACCCCGATGGCGAGGTC
CGCCACGTGCAGCACCGGCTGTGGCAGCGGCGGGACCGGGTGCGCGAGCTGGTGGACGCC
GGGGCGCGCGTGTACCTCTGCGGCGACGCGACGCGGGTGGGACCCGCGGTGGAGGAGGTG
CTGGGGCGCATCGGTCCCGGCGCCGGGTGGCTGGACGCGCTCCGCGCCGGGGGGCGGTAC
GCGACGGACGTGTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [7-461]  4.59999999999996e-114 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [9-451]  1.69999999999998e-79 PF00067
PF00067   p450
 [272-289]  1.20000117458134e-10 PR00385 [324-335]  1.20000117458134e-10 PR00385 [399-408]  1.20000117458134e-10 PR00385 [408-419]  1.20000117458134e-10 PR00385
PR00385   P450
 [8-460]  1.19999063421924e-112 SSF48264
SSF48264   Cytochrome_P450
IPR001433 Oxidoreductase FAD/NAD(P)-binding (Domain)
 [873-969]  3.1e-12 PF00175
PF00175   NAD_binding_1
IPR002401 Cytochrome P450, E-class, group I (Family)
 [261-278]  3.39999972437717e-25 PR00463 [281-307]  3.39999972437717e-25 PR00463 [323-341]  3.39999972437717e-25 PR00463 [363-387]  3.39999972437717e-25 PR00463 [398-408]  3.39999972437717e-25 PR00463 [408-431]  3.39999972437717e-25 PR00463
PR00463   EP450I
IPR003097 FAD-binding, type 1 (Domain)
 [661-837]  5.40000000000002e-24 PF00667
PF00667   FAD_binding_1
IPR008254 Flavodoxin/nitric oxide synthase (Domain)
 [488-626]  PS50902
PS50902   FLAVODOXIN_LIKE
 [490-612]  6.40000000000001e-14 PF00258
PF00258   Flavodoxin_1
IPR017927 Ferredoxin reductase-type FAD-binding domain (Domain)
 [656-864]  PS51384
PS51384   FAD_FR
IPR017938 Riboflavin synthase-like beta-barrel (Domain)
 [629-858]  4.50001022902825e-49 SSF63380
SSF63380   Riboflavin_synthase_like_b-brl
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [401-410]  PS00086
PS00086   CYTOCHROME_P450
IPR023173 NADPH-cytochrome p450 reductase, FAD-binding, alpha-helical domain-3 (Domain)
 [691-807]  3e-20 G3DSA:1.20.990.10
G3DSA:1.20.990.10   NADPH_Cyt_P450_Rdtase_dom3
IPR023206 Bifunctional cytochrome P450/NADPH--cytochrome P450 reductase (Family)
 [1-1005]  PIRSF000209
PIRSF000209   Bifunctional_P450_P450R
SignalP No significant hit
TMHMM No significant hit