close all open/close all

CDS information : Ansam_00350


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction77,332 / 76,286 / - [in whole cluster]
5,415 / 6,461 / + [in contig]
Locationcomplement(76286..77332) [in whole cluster]
5415..6461 [in contig]
TypeCDS
Length1,047 bp (348 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative RNA polymerase sigma factor
Product (GenBank)RNA polymerase sigma factor
Gene
Gene (GenBank)asm31
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q59553
PmId
[7746156] Characterization of RNA polymerase and two sigma-factor genes from Mycobacterium smegmatis. (Mol Microbiol. , 1995)
Family/Domain
FD
IPR014284, IPR000943

close this sectionSequence

selected fasta
>putative RNA polymerase sigma factor [RNA polymerase sigma factor]
MWIGYSADGRRRRPVRWWGVTEAFTWETDEDIKLAATLRRDAEAANAADSTRAYLKAIGR
VRLLTADQEVELARRVEAGLYAEHLLDLPPAARGSRRPVELRRVVRDGQRAKDHLLEANL
RLVVSIAKRYTGKGMALLDVIQEGNLGLVRAVEKFDYAKGFKFSTYATWWIRQAITRALA
DQSRTIRLPVHMVEVVTKLARIERDLLHRNGREATAEEVAVELDVTPEKVVELRQHARTP
VSLDQTIGAEADTSIGDLIADENAVAPLEAVSSALLSADLRAVLETLTPREAGVVRMRYG
FPDGVLHTLDEVGRVYGVTRERIRQIESRTMAKLQHPARSRGLEGYLD
selected fasta
>putative RNA polymerase sigma factor [RNA polymerase sigma factor]
TTGTGGATTGGCTATTCCGCGGACGGCCGTCGGCGCCGCCCGGTCCGGTGGTGGGGCGTG
ACCGAGGCCTTCACGTGGGAGACCGACGAGGACATCAAGCTGGCGGCCACGCTGCGCCGC
GACGCGGAGGCGGCGAACGCGGCCGACTCCACCCGCGCCTACCTCAAGGCGATCGGCCGG
GTGCGGCTGCTGACCGCCGACCAGGAGGTGGAGCTGGCCAGGCGGGTGGAGGCGGGCCTG
TACGCCGAGCACCTGCTGGACCTGCCGCCCGCGGCGCGCGGGTCGCGGCGGCCGGTCGAG
CTGCGGCGGGTGGTGCGGGACGGGCAGCGCGCCAAGGACCACCTGCTGGAGGCGAACCTG
CGGCTGGTGGTGAGCATCGCCAAGCGGTACACCGGCAAGGGCATGGCGCTGCTCGACGTC
ATCCAGGAGGGCAACCTGGGCCTGGTGCGCGCGGTCGAGAAGTTCGACTACGCCAAGGGG
TTCAAGTTCTCCACCTACGCCACGTGGTGGATCCGGCAGGCGATCACGCGCGCGCTGGCC
GACCAGTCGCGCACCATCCGGCTGCCCGTGCACATGGTGGAGGTGGTCACCAAGCTGGCG
CGGATCGAGCGGGACCTGCTGCACCGCAACGGGCGCGAGGCGACCGCCGAGGAGGTCGCG
GTCGAGCTGGACGTGACGCCGGAGAAGGTCGTGGAGCTGCGGCAGCACGCGCGCACGCCG
GTGTCGCTGGACCAGACCATCGGCGCGGAGGCGGACACCTCCATCGGCGACCTGATCGCG
GACGAGAACGCGGTGGCCCCGCTGGAGGCGGTCAGCTCGGCGCTGCTGTCGGCGGACCTG
CGGGCGGTGCTGGAGACGCTGACGCCGCGCGAGGCGGGCGTGGTGCGGATGCGGTACGGC
TTCCCGGACGGGGTGCTGCACACGCTGGACGAGGTTGGGCGGGTGTACGGGGTGACGCGG
GAGCGCATCCGGCAGATCGAGTCGCGCACCATGGCGAAGTTGCAGCACCCGGCGCGCTCG
CGCGGGCTGGAGGGCTACCTGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000943 RNA polymerase sigma-70 factor (Domain)
 [139-152]  9.59999914716171e-29 PR00046 [163-171]  9.59999914716171e-29 PR00046 [287-299]  9.59999914716171e-29 PR00046 [308-323]  9.59999914716171e-29 PR00046 [323-334]  9.59999914716171e-29 PR00046
PR00046   SIGMA70FCT
 [139-152]  PS00715
PS00715   SIGMA70_1
 [308-334]  PS00716
PS00716   SIGMA70_2
IPR007624 RNA polymerase sigma-70 region 3 (Domain)
 [196-270]  4.00000000000001e-20 PF04539
PF04539   Sigma70_r3
IPR007627 RNA polymerase sigma-70 region 2 (Domain)
 [115-185]  2.2e-23 PF04542
PF04542   Sigma70_r2
IPR007630 RNA polymerase sigma-70 region 4 (Domain)
 [283-336]  2e-16 PF04545
PF04545   Sigma70_r4
IPR009042 RNA polymerase sigma-70 region 1.2 (Domain)
 [49-83]  2.2e-15 PF00140
PF00140   Sigma70_r1_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [188-238]  3.5e-16 G3DSA:1.10.10.10 [279-347]  1.3e-28 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR013324 RNA polymerase sigma factor, region 3/4 (Domain)
 [188-262]  1.10000150671642e-19 SSF88659 [245-348]  5.49999338756182e-23 SSF88659
SSF88659   Sigma_r3_r4
IPR013325 RNA polymerase sigma factor, region 2 (Domain)
 [48-185]  6.20001486442668e-53 SSF88946
SSF88946   Sigma_r2
IPR014284 RNA polymerase sigma-70 (Domain)
 [111-336]  9.29999999999998e-36 TIGR02937
TIGR02937   Sigma70-ECF
SignalP
 [1-23]  0.245 Signal
Eukaryota   
TMHMM No significant hit