close all open/close all

CDS information : Ansam_00370


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction78,596 / 78,024 / - [in whole cluster]
4,151 / 4,723 / + [in contig]
Locationcomplement(78024..78596) [in whole cluster]
4151..4723 [in contig]
TypeCDS
Length573 bp (190 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)dihydrofolate reductase
Gene
Gene (GenBank)asm33
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [dihydrofolate reductase]
MRKLVYFIAASIDGVIAGPEGEHDFYPTAEPMVEHLRAEYPETTPTHVRPLVGMPLDTPN
RRYDTVLMGRGSYQPALDAGVGSPYAHLRQYVVSRSLPDADPAVALVRADPVGLVRELKR
EDGLDVWLCGGADLAGQLLPEIDELVVKTYPVVAGGGTPLFRAGFAPRAFRPVDVRAFDH
GGVVTTYRPA
selected fasta
>hypothetical protein [dihydrofolate reductase]
GTGCGCAAGCTCGTGTACTTCATCGCGGCGAGCATCGACGGCGTGATCGCGGGCCCGGAG
GGCGAGCACGACTTCTACCCGACCGCAGAGCCGATGGTCGAGCACCTGCGCGCCGAGTAC
CCCGAGACCACGCCCACCCACGTCCGCCCGCTCGTCGGGATGCCCCTGGACACCCCGAAC
CGACGCTACGACACCGTGCTCATGGGCCGGGGCAGCTACCAGCCCGCGCTCGACGCGGGC
GTGGGCAGCCCGTACGCGCACCTGCGCCAGTACGTGGTCTCCCGCTCCCTGCCCGACGCC
GATCCGGCCGTCGCGCTGGTGCGCGCGGACCCGGTCGGCCTGGTGCGGGAGCTCAAGCGG
GAGGACGGCCTGGACGTGTGGCTGTGCGGCGGCGCGGACCTGGCCGGGCAGCTGCTCCCG
GAGATCGACGAGCTGGTGGTCAAGACCTACCCGGTGGTCGCGGGCGGCGGGACCCCGCTG
TTCCGCGCCGGTTTCGCCCCGCGCGCGTTCAGGCCGGTCGACGTGCGCGCGTTCGACCAC
GGCGGCGTGGTCACCACCTACCGCCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002734 Bacterial bifunctional deaminase-reductase, C-terminal (Domain)
 [2-181]  7.30000000000002e-13 PF01872
PF01872   RibD_C
IPR024072 Dihydrofolate reductase-like domain (Domain)
 [1-190]  1e-29 SSF53597
SSF53597   SSF53597
 [3-188]  3.5e-30 G3DSA:3.40.430.10
G3DSA:3.40.430.10   G3DSA:3.40.430.10
SignalP
 [1-17]  0.966 Signal
Eukaryota   
TMHMM No significant hit