close all open/close all

CDS information : Ansam_00380


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction78,683 / 79,297 / + [in whole cluster]
4,064 / 3,450 / - [in contig]
Location78683..79297 [in whole cluster]
complement(3450..4064) [in contig]
TypeCDS
Length615 bp (204 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)asm34
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[19609582] Constitutive overexpression of asm2 and asm39 increases AP-3 production in the actinomycete Actinosynnema pretiosum. (J Ind Microbiol Biotechnol. , 2009)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
MARRNPERRAALLDAAVEVLAGEGARGLTFRAVDQRAGVPAGTASNYFAGRAEILTGAGE
RVYQRLLDQAPLGETPDGPRDRSRVTELMHALVDRVSAFPTGFLALLELRLEAARNPELR
EVLTARVRADLRFNAEHHAASGLPGDGTTVALLWLALNWLILERLTLPDLLTDHQRRDLV
TALVDRLLAGQPEEAGSPFDESGK
selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
ATGGCGCGACGCAACCCGGAGCGGCGGGCCGCGCTGCTCGACGCCGCCGTCGAGGTGCTG
GCGGGCGAGGGCGCGCGGGGGCTCACCTTCCGGGCGGTCGACCAGCGGGCCGGGGTGCCC
GCGGGCACCGCGTCGAACTACTTCGCCGGGCGCGCCGAGATCCTCACCGGCGCGGGCGAG
CGGGTCTACCAGCGGCTGCTCGACCAGGCCCCGCTGGGCGAGACCCCGGACGGCCCGCGC
GACCGGTCCCGCGTCACCGAATTGATGCACGCCCTCGTCGACCGCGTCTCGGCCTTCCCG
ACCGGTTTCCTCGCCCTGCTGGAACTGCGCCTGGAGGCCGCGCGCAACCCGGAGCTGCGC
GAGGTCCTGACCGCCCGCGTCCGCGCCGACCTGCGCTTCAACGCCGAGCACCACGCCGCC
TCCGGCCTGCCCGGCGACGGCACCACCGTGGCGCTGCTGTGGCTGGCCCTCAACTGGCTG
ATCCTGGAACGCCTCACCCTCCCCGACCTGCTGACCGACCACCAGCGCCGCGACCTCGTC
ACCGCACTGGTCGACCGGCTGCTCGCGGGGCAGCCGGAGGAGGCGGGCAGCCCGTTCGAC
GAGAGCGGAAAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [6-66]  PS50977
PS50977   HTH_TETR_2
 [12-55]  2.2e-07 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [2-70]  2.79999889404114e-12 SSF46689
SSF46689   Homeodomain_like
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [7-190]  4.2e-30 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP
 [1-27]  0.192 Signal
Eukaryota   
TMHMM No significant hit