close all open/close all

CDS information : Ansam_00390


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction79,440 / 80,618 / + [in whole cluster]
3,307 / 2,129 / - [in contig]
Location79440..80618 [in whole cluster]
complement(2129..3307) [in contig]
TypeCDS
Length1,179 bp (392 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)bicyclomycin resistant protein
Gene
Gene (GenBank)asm35
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
P28246
PmId
[2694948] Gene amplification contributes to sulfonamide resistance in Escherichia coli. (Antimicrob Agents Chemother. , 1989)
[8486276] Cloning and sequence analysis of an Escherichia coli gene conferring bicyclomycin resistance. (Gene. , 1993)

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [bicyclomycin resistant protein]
MAVGKADSAVGGWLPALLIVALTGTIIEIDMSVPSFPDIARELGVGGPAVQLTVTLNFLG
YCLGALCHGPLSDRFGRRPVLLGGSAVMLVGALGCALAPTIGLLLTARFVQGIGASAAAV
LVFVIIGDRYRGPAALRMYGLVNAAMSALMTCAPLLGGAINRVAGWRGNYLAVCATTALS
LLLVFLFLPETRTRARTAITARSVLADYRRLLGSRAYLAASLTPSLLFAAYLVFIAASPF
LYTAAFGLGVTGFALHLLVVVASFAVPSAFATGIIPLLGGPAGAVRWGLGAVVVGVLGFL
LLGDGPVAVTGSVALFCVGFAVCYPVVFDRSMSVFPELAGAASSATMGLRALLVTLLTAL
AGALSTGGPFAPAAVMAGAVAAVVLLSALSPR
selected fasta
>putative major facilitator superfamily transporter [bicyclomycin resistant protein]
TTGGCAGTGGGAAAGGCCGACAGCGCGGTGGGCGGGTGGCTGCCCGCCCTGCTCATCGTC
GCGCTCACCGGCACGATCATCGAGATCGACATGTCCGTGCCCAGCTTCCCGGACATCGCC
CGCGAACTGGGCGTGGGCGGCCCGGCCGTGCAGCTCACCGTCACCCTCAACTTCCTCGGC
TACTGCCTGGGCGCGCTGTGCCACGGCCCGCTCTCCGACCGGTTCGGCCGCCGCCCGGTG
CTGCTCGGCGGCTCCGCCGTCATGCTGGTCGGGGCGCTGGGCTGCGCGCTCGCGCCGACG
ATCGGGCTGCTGCTGACCGCCCGGTTCGTCCAGGGCATCGGGGCCAGCGCCGCCGCGGTG
CTGGTGTTCGTGATCATCGGCGACCGCTACCGGGGCCCGGCGGCGTTGCGGATGTACGGC
TTGGTGAACGCGGCCATGTCCGCGCTGATGACCTGCGCGCCGCTCCTGGGCGGGGCGATC
AACCGGGTGGCCGGGTGGCGCGGCAACTACCTCGCCGTGTGCGCCACCACCGCGCTGTCC
CTGCTGCTGGTGTTCCTGTTCCTGCCCGAGACGCGCACCCGCGCGCGCACCGCGATCACC
GCCCGGTCGGTGCTCGCCGACTACCGGAGGCTGCTCGGGAGCCGCGCCTACCTGGCCGCG
TCGCTGACGCCCAGCCTGCTGTTCGCCGCCTACCTGGTGTTCATCGCGGCCAGCCCGTTC
CTCTACACCGCCGCGTTCGGCCTCGGCGTCACCGGGTTCGCGCTGCACCTGCTCGTCGTG
GTCGCCTCGTTCGCGGTCCCCAGCGCGTTCGCCACCGGGATCATCCCGCTGCTCGGCGGC
CCGGCGGGGGCGGTGCGGTGGGGCCTGGGGGCGGTCGTGGTCGGCGTGCTGGGGTTCCTG
CTGCTCGGCGACGGCCCGGTCGCCGTGACCGGCTCGGTCGCGCTGTTCTGCGTCGGCTTC
GCCGTGTGCTACCCGGTGGTGTTCGACCGGTCCATGTCGGTGTTCCCCGAGCTGGCGGGC
GCGGCGTCCTCGGCGACCATGGGCCTGCGGGCGCTCCTGGTGACCCTGCTGACCGCCCTC
GCTGGCGCCCTGTCCACGGGCGGGCCGTTCGCCCCCGCCGCGGTGATGGCGGGGGCTGTG
GCCGCGGTGGTGCTGCTGAGCGCGCTCAGCCCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [108-128]  3.39999972437717e-05 PR01036 [138-162]  3.39999972437717e-05 PR01036
PR01036   TCRTETB
IPR011701 Major facilitator superfamily (Family)
 [26-352]  1e-34 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-391]  2.80000504261099e-49 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [9-392]  PS50850
PS50850   MFS
SignalP
 [1-24]  0.768 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o) [44-66]  Transmembrane (o-i) [79-101]  Transmembrane (i-o) [105-127]  Transmembrane (o-i) [139-161]  Transmembrane (i-o) [166-188]  Transmembrane (o-i) [216-238]  Transmembrane (i-o) [253-275]  Transmembrane (o-i) [282-301]  Transmembrane (i-o) [306-328]  Transmembrane (o-i) [341-363]  Transmembrane (i-o) [368-390]  Transmembrane (o-i)
Transmembrane 12