close all open/close all

CDS information : Ansam_00410


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction82,745 / 81,069 / - [in whole cluster]
2 / 1,678 / + [in contig]
Locationcomplement(81069..82745) [in whole cluster]
2..1678 [in contig]
TypeCDS
Length1,677 bp (558 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)unknown
Gene
Gene (GenBank)asm37
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [unknown]
MVPGLVVALAATGVLAAPASAAITSPTVTSTATTVTFEVGRTGTPAFSRVYVDTDRSAAT
GYAQGGIGADHLLENGSLYRHSGGGWAWTQVRTVPFTSASGVARWTVERADLGEQASPND
VDVVFQVEAPVETSAKVTHTYTAGAGGSVAYQPSSANVPNPERGLYHHTGDCDKADLSAD
ALRRYRTEQGITLAMCVFYLAEHRSSPIAQTALDRLQRQFDAARVAGVKLVLRFAYTASE
SGEDAPKERVLAHIDQLAPLLRANADVTAVVQAGFVGAWGEWYYTKNFGNAGVVSATDQA
NRKAVVDKLLTALPADRAVQLRTPKFKRALYGGGSTRIGHHNDCFLASDTDFGTYEDPAT
EYPYLEAETRTLPMGGETCAVNPPRTDCPTATAELSRFHWTYLNTDYQQDVLRAWSAQGC
LAEVTAKLGYRFTLRDSVFPTTTTRGAALPVRVNLTNDGYAAAVNQRTVNLVLRNTTTGA
LTRLPLTADPRTWLPGARAIAQDAQIPPSLATGQYALLLELADPALPGRPEYSIQTANTG
LWDARTGLNDLKQTITVS
selected fasta
>hypothetical protein(fragment) [unknown]
ATCGTGCCGGGTCTGGTGGTGGCCCTCGCCGCCACCGGCGTCCTCGCGGCCCCCGCGAGC
GCCGCCATCACCAGCCCCACCGTGACCAGCACCGCCACCACCGTCACCTTCGAGGTCGGC
CGCACCGGGACGCCCGCGTTCTCGCGCGTCTACGTCGACACCGACCGCAGCGCGGCCACC
GGCTACGCGCAGGGCGGGATCGGGGCGGACCACCTGCTGGAGAACGGTTCCCTCTACCGC
CACAGCGGCGGCGGCTGGGCGTGGACGCAGGTGCGGACCGTGCCGTTCACCTCCGCCTCG
GGCGTCGCGCGGTGGACCGTCGAGCGGGCCGACCTCGGCGAGCAGGCGAGCCCGAACGAC
GTCGACGTGGTGTTCCAGGTCGAGGCCCCGGTGGAGACCTCGGCGAAGGTCACCCACACC
TACACCGCGGGCGCGGGCGGCTCGGTCGCCTACCAGCCGTCGAGCGCGAACGTCCCCAAC
CCGGAACGCGGTCTTTACCACCACACCGGCGACTGCGACAAGGCCGACCTGTCCGCCGAC
GCGCTGCGCCGGTACCGCACCGAGCAGGGCATCACCCTCGCGATGTGCGTGTTCTACCTG
GCCGAGCACCGCTCGTCCCCGATCGCCCAGACCGCCCTCGACCGCCTGCAGCGCCAGTTC
GACGCCGCGCGGGTCGCGGGCGTGAAGCTGGTGCTGCGCTTCGCCTACACCGCGTCGGAG
TCCGGCGAGGACGCGCCGAAGGAGCGGGTCCTGGCGCACATCGACCAGCTCGCGCCGCTG
CTGCGCGCGAACGCGGACGTGACCGCCGTGGTGCAGGCCGGGTTCGTCGGCGCGTGGGGC
GAGTGGTACTACACCAAGAACTTCGGCAACGCGGGCGTCGTCTCCGCGACCGACCAGGCC
AACCGCAAGGCGGTGGTGGACAAGCTCCTGACCGCGCTCCCGGCGGACCGGGCGGTGCAG
CTGCGCACGCCGAAGTTCAAGCGCGCCCTGTACGGGGGCGGCAGCACCAGGATCGGCCAC
CACAACGACTGCTTCCTGGCCAGCGACACGGACTTCGGCACCTACGAGGACCCGGCGACC
GAATACCCGTACCTGGAGGCGGAGACGCGGACGCTGCCGATGGGCGGCGAGACCTGCGCG
GTGAACCCGCCCCGCACCGACTGCCCGACCGCGACCGCCGAGCTGTCCCGCTTCCACTGG
ACGTACCTGAACACCGACTACCAGCAGGACGTGCTGCGCGCGTGGTCGGCGCAGGGCTGC
CTGGCGGAGGTCACGGCCAAGCTCGGCTACCGCTTCACCCTGCGCGACTCGGTGTTCCCC
ACGACGACCACCAGGGGCGCCGCGCTGCCCGTGCGGGTGAACCTGACCAACGACGGCTAC
GCCGCGGCGGTGAACCAGCGCACCGTGAACCTGGTGCTGCGCAACACCACCACCGGCGCC
CTGACCCGCCTCCCGCTCACCGCGGACCCCCGGACCTGGCTGCCGGGCGCCCGCGCCATC
GCGCAGGACGCCCAGATCCCGCCGTCGCTCGCGACGGGGCAGTACGCGCTCCTGCTGGAA
CTGGCCGACCCCGCCCTGCCGGGCCGCCCGGAGTACTCGATCCAGACGGCGAACACCGGC
CTGTGGGACGCGAGGACGGGGCTGAACGACCTGAAGCAGACCATCACGGTGTCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-21]  1 Signal
Eukaryota   
 [1-21]  1 Signal
Bacteria, Gram-positive   
 [1-21]  1 Signal
Bacteria, Gram-negative   
TMHMM No significant hit