close all open/close all

CDS information : Ansam_00420


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction82,845 / 84,125 / + [in whole cluster]
99 / 1,379 / + [in contig]
Location82845..84125 [in whole cluster]
99..1379 [in contig]
TypeCDS
Length1,281 bp (426 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative diaminopimelate decarboxylase
Product (GenBank)diaminopimelate decarboxylase
Geneasm38
lysA
Gene (GenBank)lysA
EC number4.1.1.20
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
P0A5M4
PmId
[8440471] Cloning of the lysA gene from Mycobacterium tuberculosis. (Gene. , 1993)
Family/Domain
FD
IPR002986

close this sectionSequence

selected fasta
>putative diaminopimelate decarboxylase [diaminopimelate decarboxylase]
MTGEPALETGLWPLGTRLERGELLLGGVPATELAARFGTPCQVLDEGTVRARARAFREAL
PEAEVVFAGKALPCREVYRWVADEGLSLDVCSAGELAIARSVGFPAERVLLHGNVKTPED
LKAALGYGVGRVVVDSFDEIEQLGALAEGPQDVLVRVTPGVDPRTHRAVATGVEDQKFGF
SLAGGDALEAVLRVVEQPSLRLVGLHCHVGSQVRHVAVYEEAARRVVGLIASCGVRIEQL
DLGGGFAVPYLPGEGEFDLGGFAHRVRVALSHECALRRVPVPRLSIEPGRAVVARAGVTL
YRVAAVKRGVRRVFVAVDGGMSDNPRPALYGSRYAVRLVRRGGRRAPVTVVGRHCEAGDV
LAEDVPLPEDVRAGDLLAVPVTGAYHHALASNYNAVGRPPVVGVRDGVARVLVRRETEED
LLRREV
selected fasta
>putative diaminopimelate decarboxylase [diaminopimelate decarboxylase]
ATGACCGGCGAACCGGCCCTGGAGACGGGGCTGTGGCCCCTCGGGACCCGGCTGGAGCGG
GGGGAGCTGCTGCTCGGCGGGGTGCCCGCGACCGAGCTCGCCGCCCGGTTCGGCACGCCC
TGCCAGGTGCTCGACGAGGGCACGGTCCGGGCGCGGGCGCGCGCGTTCCGGGAGGCGCTG
CCGGAGGCGGAGGTGGTGTTCGCGGGCAAGGCGCTGCCGTGCCGCGAGGTGTACCGGTGG
GTGGCGGACGAGGGGCTGTCGCTGGACGTGTGCTCGGCCGGGGAGCTGGCGATCGCGCGG
TCGGTCGGGTTCCCGGCGGAGCGCGTCCTGCTGCACGGCAACGTCAAGACCCCTGAGGAC
CTCAAGGCCGCGCTCGGGTACGGGGTCGGGCGGGTGGTGGTGGACTCGTTCGACGAGATC
GAGCAGCTCGGGGCGCTGGCCGAGGGGCCGCAGGACGTGCTGGTCCGGGTCACCCCCGGC
GTCGACCCGCGCACCCACCGGGCGGTGGCGACCGGGGTGGAGGACCAGAAGTTCGGCTTC
TCGCTCGCGGGCGGGGACGCGCTGGAGGCGGTGCTGCGGGTGGTCGAGCAGCCGTCGCTG
CGCCTGGTCGGGCTGCACTGCCACGTCGGGTCGCAGGTGCGGCACGTCGCGGTGTACGAG
GAGGCTGCGCGGCGGGTGGTCGGGCTGATCGCCTCGTGCGGGGTGCGGATCGAGCAGCTG
GACCTCGGCGGCGGGTTCGCGGTGCCGTACCTGCCGGGGGAGGGGGAGTTCGACCTGGGC
GGGTTCGCGCACCGGGTGCGGGTGGCGCTGAGCCACGAGTGCGCGCTGCGGCGCGTGCCG
GTGCCGAGGTTGTCGATCGAGCCGGGGCGGGCGGTCGTGGCGCGGGCGGGCGTGACGCTG
TACCGGGTGGCGGCGGTCAAGCGCGGGGTGAGGCGGGTGTTCGTGGCCGTGGACGGCGGC
ATGAGCGACAACCCCAGGCCCGCGCTGTACGGGAGCCGGTACGCGGTGCGCCTGGTCCGC
CGCGGCGGGCGGCGCGCGCCGGTGACGGTGGTGGGCAGGCACTGCGAGGCGGGCGACGTG
CTCGCCGAGGACGTGCCGCTGCCCGAGGACGTGCGCGCCGGGGACCTGCTGGCGGTGCCG
GTGACCGGTGCTTACCACCACGCGCTGGCGTCGAACTACAACGCCGTGGGCAGGCCGCCG
GTGGTGGGGGTGCGCGACGGCGTCGCGCGGGTGCTGGTGCGGCGGGAGACGGAGGAGGAC
CTGCTGCGGCGGGAGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000183 Ornithine/DAP/Arg decarboxylase (Family)
 [67-85]  1.6e-17 PR01179 [87-99]  1.6e-17 PR01179 [199-212]  1.6e-17 PR01179 [284-303]  1.6e-17 PR01179 [383-396]  1.6e-17 PR01179
PR01179   ODADCRBXLASE
IPR002986 Diaminopimelate decarboxylase, LysA (Family)
 [18-426]  2.6e-123 TIGR01048
TIGR01048   lysA: diaminopimelate decarboxylase
 [85-102]  3.1e-24 PR01181 [171-180]  3.1e-24 PR01181 [312-330]  3.1e-24 PR01181 [393-415]  3.1e-24 PR01181
PR01181   DAPDCRBXLASE
 [27-426]  39.196 MF_02120
MF_02120   LysA
IPR009006 Alanine racemase/group IV decarboxylase, C-terminal (Domain)
 [266-426]  3.8e-49 SSF50621
SSF50621   Alanine racemase C-terminal domain-like
 [289-426]  3.8e-42 G3DSA:2.40.37.10
G3DSA:2.40.37.10   no description
IPR022643 Orn/DAP/Arg decarboxylase 2, C-terminal (Domain)
 [301-403]  1.2e-20 PF00278
PF00278   Orn_DAP_Arg_deC
IPR022644 Orn/DAP/Arg decarboxylase 2, N-terminal (Domain)
 [49-294]  7.5e-54 PF02784
PF02784   Orn_Arg_deC_N
SignalP No significant hit
TMHMM No significant hit