close all open/close all

CDS information : Ansam_00430


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction84,660 / 84,226 / - [in whole cluster]
1,914 / 1,480 / - [in contig]
Locationcomplement(84226..84660) [in whole cluster]
complement(1480..1914) [in contig]
TypeCDS
Length435 bp (144 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative anti-sigma factor
Product (GenBank)unknown
Geneasm39
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF2
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[19609582] Constitutive overexpression of asm2 and asm39 increases AP-3 production in the actinomycete Actinosynnema pretiosum. (J Ind Microbiol Biotechnol. , 2009)
Family/Domain
FD
IPR003594

close this sectionSequence

selected fasta
>putative anti-sigma factor [unknown]
MDEVDDPTTQPAPEPGTPAPATLDLTARPALAEVRRWTGALLADADEESADDVLLVVNEL
VANAYDHTTSPLALRVTTTPDHVRVEVEDGSPDPPRPDLTAGLRQIGTRGRGLLLIRQLT
DRWGSAPHPGGKTVWAELPNVPAP
selected fasta
>putative anti-sigma factor [unknown]
ATGGACGAGGTGGACGACCCGACCACCCAGCCCGCCCCCGAGCCCGGCACACCGGCACCG
GCCACGCTGGACCTCACGGCCCGCCCGGCCCTGGCCGAGGTGCGCCGCTGGACCGGCGCG
CTCCTGGCCGACGCGGACGAGGAGTCGGCGGACGACGTGCTGCTCGTGGTCAACGAGCTG
GTCGCCAACGCCTACGACCACACCACCTCCCCACTCGCCCTGCGCGTCACGACCACCCCG
GACCACGTGCGCGTGGAGGTCGAGGACGGCTCCCCCGACCCGCCGCGCCCGGACCTCACC
GCGGGCCTGCGCCAGATCGGCACGCGCGGGCGCGGCCTGCTGCTGATCCGCCAGCTGACC
GACCGCTGGGGCAGCGCGCCCCACCCCGGCGGCAAGACCGTGTGGGCGGAGCTGCCGAAC
GTCCCCGCGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [48-142]  0.00400000081278151 SM00387
SM00387   HATPase_c
 [50-139]  3.7e-09 PF02518
PF02518   HATPase_c
 [50-143]  1e-08 SSF55874
SSF55874   ATP_bd_ATPase
 [47-139]  7.5e-05 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
SignalP No significant hit
TMHMM No significant hit