close all open/close all

CDS information : Ansam_00440


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction85,408 / 85,022 / - [in whole cluster]
2,662 / 2,276 / - [in contig]
Locationcomplement(85022..85408) [in whole cluster]
complement(2276..2662) [in contig]
TypeCDS
Length387 bp (128 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative anti-sigma factor antagonist
Product (GenBank)unknown
Geneasm40
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q56QW5
PmId
[15793135] Expression of ccaR, encoding the positive activator of cephamycin C and clavulanic acid production in Streptomyces clavuligerus, is dependent on bldG. (Antimicrob Agents Chemother. , 2005)
ACC
Q9WVX8
PmId
[12900026] The putative anti-anti-sigma factor BldG is post-translationally modified by phosphorylation in Streptomyces coelicolor. (FEMS Microbiol Lett. , 2003)

close this sectionSequence

selected fasta
>putative anti-sigma factor antagonist [unknown]
MSELDAAAVVTVASDVVRGVPVLRVAGEIDANVADEVRRALLPWLDGLRGPGVLDLTGVR
FMASTGLSLLVEAARRGRARLVLATAQRGVLRPLQLTGMSALLPTHPTVDLAVDAQRGAD
LTRMPSTA
selected fasta
>putative anti-sigma factor antagonist [unknown]
GTGTCCGAGCTGGATGCAGCCGCGGTGGTCACGGTGGCTTCCGACGTGGTGCGCGGGGTG
CCCGTGCTGCGCGTCGCCGGGGAGATCGACGCCAACGTCGCGGACGAGGTCCGCCGGGCG
CTGCTGCCCTGGTTGGACGGGTTGCGCGGGCCGGGGGTGCTCGACCTGACCGGGGTGCGG
TTCATGGCCTCCACGGGGTTGTCGCTGCTGGTCGAGGCGGCTCGGCGCGGCCGGGCGCGG
CTGGTGCTGGCCACCGCGCAGCGCGGCGTGCTCCGGCCGCTGCAGCTGACCGGGATGAGC
GCGCTGCTCCCCACGCACCCCACCGTGGACCTGGCCGTCGACGCCCAGCGCGGGGCCGAC
CTGACCAGGATGCCCAGCACGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002645 STAS domain (Domain)
 [10-114]  7.99999145876753e-20 SSF52091
SSF52091   STAS
 [18-111]  9.60000000000001e-11 PF01740
PF01740   STAS
 [14-115]  8.80000000000003e-19 G3DSA:3.30.750.24
G3DSA:3.30.750.24   STAS
 [10-116]  PS50801
PS50801   STAS
IPR003658 Anti-sigma factor antagonist (Family)
 [11-110]  1.6e-25 TIGR00377
TIGR00377   Ant_ant_sig
SignalP No significant hit
TMHMM No significant hit