close all open/close all

CDS information : Ansam_00450


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction85,709 / 86,281 / + [in whole cluster]
2,963 / 3,535 / + [in contig]
Location85709..86281 [in whole cluster]
2963..3535 [in contig]
TypeCDS
Length573 bp (190 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Geneasm41
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF4; contains putative transmembrane helix
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MVRSPVRRRAVVVVSGVVVVAALVGLWVFQPWRLWTRSEADEALPAEFTASTSAGPSTGA
ASSGAPTPSAPTSAPVDQPAVLATGGFVTQEHETRGTATVLRNGAARVLRLEGFSTSDGP
DLHIWLSDATAGGEWGKYDDGRYLPLGPMKATDGNQNYPIPEDADLSGLRSVVVWCDRFN
VAFGSAPLDL
selected fasta
>hypothetical protein [unknown]
GTGGTGCGCAGTCCCGTGCGCAGGAGAGCGGTCGTGGTGGTGTCCGGGGTCGTGGTGGTG
GCCGCGCTCGTGGGGTTGTGGGTGTTCCAGCCGTGGCGGTTGTGGACGCGCAGCGAGGCG
GACGAGGCGCTGCCCGCCGAGTTCACCGCCTCGACCAGCGCGGGGCCGAGCACCGGGGCG
GCGAGCAGCGGCGCCCCGACGCCCAGCGCCCCGACGTCGGCGCCCGTCGACCAGCCCGCG
GTGCTGGCCACGGGCGGGTTCGTCACCCAGGAGCACGAGACGCGGGGCACCGCCACCGTG
CTGCGCAACGGGGCCGCGCGCGTGCTGCGGCTGGAGGGGTTCTCCACCTCGGACGGGCCC
GACCTGCACATCTGGCTCTCCGACGCGACCGCGGGCGGCGAGTGGGGCAAGTACGACGAC
GGGCGCTACCTGCCGCTCGGCCCCATGAAGGCCACCGACGGCAACCAGAACTACCCGATC
CCGGAGGACGCGGACCTGTCGGGGCTGCGCAGCGTCGTGGTGTGGTGCGACCGGTTCAAC
GTGGCCTTCGGGTCGGCGCCGCTGGACCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019545 DM13 domain (Domain)
 [80-189]  PS51549
PS51549   DM13
 [87-188]  2.1e-28 PF10517
PF10517   DM13
SignalP
 [1-40]  0.516 Signal
Bacteria, Gram-positive   
TMHMM
 [12-29]  Transmembrane (i-o)
Transmembrane 1