close all open/close all

CDS information : Ansam_00460


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction87,308 / 86,298 / - [in whole cluster]
4,562 / 3,552 / - [in contig]
Locationcomplement(86298..87308) [in whole cluster]
complement(3552..4562) [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Geneasm42
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF5; similar to transmembrane proteins EpiH and GdmH
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O07474
PmId
[9150266] Secretion of the lantibiotics epidermin and gallidermin: sequence analysis of the genes gdmT and gdmH, their influence on epidermin production and their regulation by EpiQ. (Mol Gen Genet. , 1997)
[11229936] Dual role of GdmH in producer immunity and secretion of the Staphylococcal lantibiotics gallidermin and epidermin. (Appl Environ Microbiol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MGALIVAVVLLVVFLVQLKREPRRLGNGVYLLMSLAFLALWLLTLAEPQTRVLVVGAVVL
IAPVFVVVIALFLIANGVTLLRREGFKPGNALSFGAGTAILGVVGGLLLVLLSALREGSP
EPWVLAAAGSLFLLAGYLGFAFTLFLLYSVLYGRVRKRTGHTAIVVLGAGVPGGRVTPLL
AGRLDRALKLYRRAAAKGASPLVVASGGQGPDEPASEAEVMANYLRERGIPDEALLEERE
STSTWENLRLSSALLAERGVTGRLLVVTSSYHVPRAAILSRRAGLKADVRGGRTAWYFVP
NAFLREFAALLVQYRALNALAACTALSVFPLLAYGV
selected fasta
>hypothetical protein [unknown]
ATGGGGGCTCTGATCGTCGCGGTGGTGCTGCTCGTCGTCTTCCTGGTGCAGCTCAAGCGG
GAGCCCAGACGACTGGGCAACGGCGTGTACCTGCTGATGAGCCTGGCGTTCCTCGCGCTC
TGGCTGCTCACCCTGGCCGAACCGCAGACCAGGGTGCTGGTGGTCGGCGCCGTGGTGCTG
ATCGCCCCGGTGTTCGTCGTCGTGATCGCGCTCTTCCTGATCGCCAACGGCGTGACCCTG
CTGCGGCGCGAGGGTTTCAAGCCGGGCAACGCCCTCTCCTTCGGCGCGGGCACGGCCATC
CTGGGCGTGGTGGGCGGCCTGCTCCTGGTCCTGCTGTCCGCGCTGCGCGAGGGCTCCCCC
GAGCCGTGGGTGCTGGCGGCGGCCGGTTCGCTGTTCCTGCTCGCGGGCTACCTCGGCTTC
GCCTTCACCCTCTTCCTGCTCTACTCAGTGCTCTACGGCCGCGTCCGCAAGCGCACCGGC
CACACCGCCATCGTCGTCCTGGGCGCGGGCGTCCCCGGAGGCCGCGTCACCCCGCTCCTC
GCGGGCCGCCTGGACCGCGCGCTGAAGCTCTACCGCCGCGCCGCGGCCAAGGGCGCTTCC
CCCCTGGTGGTCGCCTCCGGCGGCCAGGGCCCCGACGAGCCCGCCTCCGAGGCCGAGGTC
ATGGCGAACTACCTGCGCGAGCGCGGCATCCCGGACGAGGCGCTCCTGGAGGAGCGCGAG
TCCACCTCCACCTGGGAGAACCTCCGCCTCTCCTCCGCCCTGCTCGCCGAGCGCGGCGTC
ACCGGCAGGCTCCTCGTGGTCACCAGCAGCTACCACGTCCCCCGAGCCGCGATCCTGTCC
CGCCGCGCGGGCCTGAAGGCGGACGTCCGGGGCGGTCGCACCGCCTGGTACTTCGTCCCG
AACGCCTTCCTCCGCGAGTTCGCCGCGCTCCTGGTCCAGTACCGCGCCCTCAACGCCCTG
GCCGCCTGCACCGCGCTGTCCGTCTTCCCGCTGCTGGCCTACGGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003848 Domain of unknown function DUF218 (Domain)
 [162-289]  6.49999999999992e-38 PF02698
PF02698   DUF218
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [161-296]  3.09999999999998e-34 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
SignalP No significant hit
TMHMM
 [4-18]  Transmembrane (o-i) [25-44]  Transmembrane (i-o) [59-81]  Transmembrane (o-i) [93-115]  Transmembrane (i-o) [130-152]  Transmembrane (o-i) [311-333]  Transmembrane (i-o)
Transmembrane 6