close all open/close all

CDS information : Ansam_00480


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction88,846 / 90,009 / + [in whole cluster]
6,100 / 7,263 / + [in contig]
Location88846..90009 [in whole cluster]
6100..7263 [in contig]
TypeCDS
Length1,164 bp (387 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative UDP-glucose C-3 dehydrogenase
Product (GenBank)oxidoreductase
Geneasm44
Gene (GenBank)
EC number
Keyword
  • AHBA
Note
Note (GenBank)
  • ORF7; similar to RifL in the rifamycin biosynthetic gene cluster
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q7BUE1
NITE
Rifam_00320
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207504] Kanosamine biosynthesis: a likely source of the aminoshikimate pathway's nitrogen atom. (J Am Chem Soc. , 2002)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
[21081954] The biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), the precursor of mC7N units in ansamycin and mitomycin antibiotics: a review. (J Antibiot (Tokyo). , 2011)

close this sectionSequence

selected fasta
>putative UDP-glucose C-3 dehydrogenase [oxidoreductase]
MSAGSGGVRGGPVRVAVVGLGWVAREVWLPRLLGGAAYRVVAVVEPSARARAAVLGDLTG
VAALERAEDLRRDEVDLAVVAVPNHLHAPVASGLLRRGVPVFLEKPLCLGSAEAAALTAA
ERAGGAVLLGGSAARHRADVRALREVAASLGALRHVDVSWVRSRGIPDRGGWFTDRTRSG
GGALVDLGWHLLDTARVLLRGATGDPEGAELEHVTGAVSADFVDDHAFRAAWRGDGAQAD
PVVGDVEDTARGFLVTRSGISIGVRAAWASHQALDTTVVRVEGSGGTAELRCTFGFSPNR
EGPSRLLLTTDGRTTPVELPAEPVGAEYDAQLASLPARLADPAARGEAASGARWIAGAIE
RVYRAADAVRCAERRHAPVDLAPTGAP
selected fasta
>putative UDP-glucose C-3 dehydrogenase [oxidoreductase]
GTGAGCGCCGGGAGCGGTGGCGTGCGCGGTGGACCGGTGCGGGTGGCGGTGGTCGGGCTC
GGGTGGGTGGCGCGGGAGGTGTGGCTGCCCCGGTTGCTGGGCGGCGCCGCCTACCGGGTG
GTCGCCGTGGTCGAGCCGTCCGCGCGGGCCCGCGCCGCCGTGCTCGGCGACCTCACCGGG
GTCGCCGCGCTGGAGCGGGCGGAGGACCTGCGCCGCGACGAGGTCGACCTGGCGGTGGTC
GCCGTGCCGAACCACCTGCACGCGCCGGTCGCGTCCGGTCTGCTGCGGCGGGGCGTCCCG
GTGTTCCTGGAGAAGCCGCTGTGCCTGGGGTCCGCCGAGGCCGCCGCGCTCACCGCCGCC
GAGCGGGCCGGTGGCGCGGTGCTGCTGGGCGGGAGCGCCGCGCGGCACCGGGCCGACGTG
CGGGCGCTGCGGGAGGTGGCCGCGTCGCTGGGCGCGCTGCGGCACGTCGACGTGTCCTGG
GTGCGGTCCAGGGGCATCCCGGACCGGGGCGGCTGGTTCACCGACCGCACCCGCTCCGGC
GGCGGCGCGCTGGTCGACCTCGGCTGGCACCTGCTCGACACCGCCCGCGTGCTGCTGCGC
GGCGCCACCGGTGACCCGGAGGGCGCGGAGCTGGAGCACGTCACCGGCGCGGTGTCCGCG
GACTTCGTCGACGACCACGCGTTCCGCGCCGCCTGGCGCGGCGACGGGGCGCAGGCGGAC
CCGGTGGTCGGCGACGTGGAGGACACCGCCAGGGGATTCCTCGTCACCCGGTCGGGGATC
TCGATCGGGGTGCGCGCGGCCTGGGCCTCGCACCAGGCGCTGGACACCACCGTCGTGCGC
GTGGAGGGCAGCGGCGGCACGGCCGAGCTGCGCTGCACCTTCGGCTTCAGCCCGAACCGC
GAGGGCCCGTCGCGGCTCCTGCTCACCACCGACGGCCGCACCACCCCGGTCGAGCTGCCC
GCCGAGCCGGTGGGCGCCGAGTACGACGCCCAGCTCGCGAGCCTGCCCGCCCGCCTGGCC
GACCCCGCCGCGCGCGGCGAGGCCGCGTCCGGGGCGCGCTGGATCGCGGGCGCGATCGAA
CGGGTCTACCGCGCCGCCGACGCCGTGCGGTGCGCCGAACGACGACACGCGCCGGTCGAC
CTCGCCCCGACGGGAGCCCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [13-127]  8.70000000000003e-18 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [149-199]  1.5e-05 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [12-151]  1.99999999999999e-27 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit