close all open/close all

CDS information : Ansam_00490


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction90,285 / 90,923 / + [in whole cluster]
7,539 / 8,177 / + [in contig]
Location90285..90923 [in whole cluster]
7539..8177 [in contig]
TypeCDS
Length639 bp (212 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative hydrolase
Product (GenBank)phosphatase
Geneasm45
Gene (GenBank)
EC number
Keyword
  • AHBA
Note
Note (GenBank)
  • ORF8; similar to phosphoglycolate phosphatases and RifM in the rifamycin biosynthetic gene cluster
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O52553
NITE
Rifam_00330
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
ACC
P32662
PmId
[13129953] Role of 2-phosphoglycolate phosphatase of Escherichia coli in metabolism of the 2-phosphoglycolate formed in DNA repair. (J Bacteriol. , 2003)
Family/Domain
FD
IPR006439

close this sectionSequence

selected fasta
>putative hydrolase [phosphatase]
MLFDLDGVLVNSFAVMRQAFEIAYTEVVGDGPAPFEEYNRHLGRYFPDIMRIMGLPLEVE
GPFVRESYRLAGEVEVFEGAPELLADLRQHGFGTAVVTGKSGPRARSLLTTLGLAELFDH
VIGSDEVVNPKPAPDMLLLATGLLGVPADRVVMVGDALTDLASARAAGYPALAALWGETD
EAELLAANPDAAVRKPSQVLDWCLAHLADDRT
selected fasta
>putative hydrolase [phosphatase]
GTGCTGTTCGACCTCGACGGGGTGCTGGTCAACAGCTTCGCCGTCATGCGGCAGGCGTTC
GAGATCGCCTACACCGAGGTCGTCGGCGACGGGCCCGCGCCGTTCGAGGAGTACAACCGG
CACCTGGGGCGGTACTTCCCGGACATCATGCGGATCATGGGCCTGCCGCTGGAGGTGGAG
GGGCCGTTCGTCCGCGAGAGCTACCGGCTCGCGGGTGAGGTCGAGGTGTTCGAGGGCGCG
CCGGAGCTGCTGGCGGACCTGCGGCAGCACGGCTTCGGCACCGCCGTGGTCACCGGCAAG
AGCGGCCCGCGCGCCCGGTCGCTGCTGACCACCCTCGGCCTGGCGGAGCTGTTCGACCAC
GTCATCGGCTCCGACGAGGTCGTGAACCCCAAGCCCGCGCCGGACATGCTCCTGCTGGCC
ACCGGCCTGCTCGGCGTCCCGGCCGACCGGGTGGTGATGGTGGGCGACGCCCTGACCGAC
CTGGCGAGCGCCCGCGCCGCGGGCTACCCGGCGCTGGCCGCGCTGTGGGGCGAGACGGAC
GAGGCGGAGCTGCTGGCGGCGAACCCGGACGCGGCGGTCCGCAAGCCCTCGCAGGTGCTC
GACTGGTGCCTGGCCCACCTCGCCGACGACCGGACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005833 Haloacid dehalogenase/epoxide hydrolase (Family)
 [87-100]  7.60000011115813e-05 PR00413 [118-134]  7.60000011115813e-05 PR00413 [136-156]  7.60000011115813e-05 PR00413
PR00413   HADHALOGNASE
IPR006351 3-amino-5-hydroxybenzoic acid synthesis-related (Family)
 [1-205]  1.69999999999998e-119 TIGR01454
TIGR01454   AHBA_synth_RP
IPR006402 HAD-superfamily hydrolase, subfamily IA, variant 3 (Family)
 [79-169]  2.6e-09 TIGR01509
TIGR01509   HAD-SF-IA-v3
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [76-168]  3.7e-08 TIGR01549
TIGR01549   HAD-SF-IA-v1
IPR023214 HAD-like domain (Domain)
 [1-203]  1.49999648196323e-46 SSF56784
SSF56784   HAD-like_dom
 [2-16]  9.8e-40 G3DSA:3.40.50.1000 [69-202]  9.8e-40 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit