close all open/close all

CDS information : Ansam_00510


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction91,828 / 92,856 / + [in whole cluster]
9,082 / 10,110 / + [in contig]
Location91828..92856 [in whole cluster]
9082..10110 [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodehydroquinate synthase
Product (GenBank)aminodehydroquinate synthase
Geneasm47
Gene (GenBank)
EC number4.2.3.-
Keyword
  • AHBA
Note
Note (GenBank)
  • ORF10; similar to RifG in the rifamycin biosynthetic gene cluster
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O52549
NITE
Rifam_00280
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
ACC
P0A4Z4
PmId
[17586643] Functional characterization by genetic complementation of aroB-encoded dehydroquinate synthase from Mycobacterium tuberculosis H37Rv and its heterologous expression and purification. (J Bacteriol. , 2007)
[1910148] The Mycobacterium tuberculosis shikimate pathway genes: evolutionary relationship between biosynthetic and catabolic 3-dehydroquinases. (Mol Gen Genet. , 1991)

close this sectionSequence

selected fasta
>putative aminodehydroquinate synthase [aminodehydroquinate synthase]
MPTTATTREVRVELGERAYTVHIGHGVRAALPDVVRALGARRAVVVTARPPDQTPDPGVP
SLVLPARDGEHDKTLATVAHLCSRFAEFGLTRADVVVSCGGGTTTDAVGLAASLYHRGTP
VVHVPTSLLAQVDASVGGKTAVNLPEGKNLVGSYWQPAAVLCDLDLLATLPERELRNGLG
EIARCHFIGAPGLDRLPLLDQVAASVALKARVVAADERDRGLRHTLNYGHTLGHALELAT
GFAVRHGEGVAIGTVFAGRLAGALGRIGPDRVAEHHAVVAGYGLPVALPPGVPDDELLRF
VRRDKKSTGGLAFVLDGPRGAELVRDVDEHVVAATLAAMPRA
selected fasta
>putative aminodehydroquinate synthase [aminodehydroquinate synthase]
GTGCCCACCACCGCCACCACCCGCGAGGTCCGGGTCGAGCTGGGCGAGCGCGCCTACACC
GTCCACATCGGACACGGCGTGCGCGCCGCCCTCCCGGACGTCGTGCGGGCCCTCGGCGCG
CGCCGCGCCGTCGTGGTCACCGCCCGCCCGCCGGACCAGACGCCCGACCCCGGCGTCCCC
TCCCTCGTCCTCCCGGCCCGCGACGGCGAGCACGACAAGACCCTCGCCACCGTCGCCCAC
CTGTGCAGCCGGTTCGCCGAGTTCGGCCTGACCCGCGCCGACGTCGTCGTCTCCTGCGGC
GGCGGCACCACCACCGACGCGGTCGGCCTCGCCGCCTCGCTCTACCACCGGGGCACACCG
GTCGTGCACGTGCCGACCTCGCTGCTCGCCCAGGTCGACGCGAGCGTCGGCGGCAAGACG
GCGGTCAACCTCCCCGAGGGCAAGAACCTCGTCGGCTCCTACTGGCAGCCCGCCGCCGTG
CTGTGCGACCTCGACCTGCTCGCCACCCTGCCCGAGCGCGAGCTGCGCAACGGCCTCGGC
GAGATCGCCCGCTGCCACTTCATCGGCGCGCCGGGCCTTGACCGGTTGCCGCTGCTGGAC
CAGGTGGCGGCGAGCGTCGCCCTCAAGGCCCGCGTGGTGGCCGCCGACGAGCGCGACCGC
GGCCTGCGGCACACCCTCAACTACGGCCACACCCTCGGCCACGCCCTGGAGCTCGCCACC
GGTTTCGCGGTGCGGCACGGCGAGGGCGTCGCGATCGGCACGGTCTTCGCCGGCCGCCTG
GCGGGCGCGCTCGGCCGGATCGGCCCGGACCGGGTGGCCGAGCACCACGCCGTGGTCGCG
GGCTACGGGCTGCCGGTCGCGCTGCCGCCGGGCGTGCCGGACGACGAGCTGCTGCGGTTC
GTGCGCCGCGACAAGAAGTCCACCGGCGGCCTGGCGTTCGTGCTCGACGGCCCGCGCGGC
GCGGAGCTGGTGCGCGACGTCGACGAGCACGTCGTCGCCGCCACCCTGGCCGCGATGCCG
CGGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016037 3-dehydroquinate synthase AroB (Family)
 [8-342]  2.50000909916183e-76 PIRSF001455
PIRSF001455   DHQ_synth
SignalP No significant hit
TMHMM No significant hit