close all open/close all
first first   Aran_00020 Aran_00020

CDS information : Aran_00010


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction1,541 / 711 / - [in whole cluster]
1,541 / 711 / - [in contig]
Locationcomplement(711..1541) [in whole cluster]
complement(711..1541) [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative DNA-binding protein
Product (GenBank)SCC75A.25c
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in aranciamycin biosynthesis.
Note (GenBank)
  • hypothetical protein; orf1
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
Q9FDT3
PmId
[15849419] DNA-binding protein involved in the regulation of chitinase production in Streptomyces lividans. (Biosci Biotechnol Biochem. , 2005)
Family/Domain
FD
IPR001387

close this sectionSequence

selected fasta
>putative DNA-binding protein [SCC75A.25c]
MQSRGDDLSSALSRFADAAQRCRLAAGLSREEVAERTRCAEADVERIENAEQMPSRSYAV
EADRLLGADGALVALWPPLVRSAYPEWFWQVVELEQQASFVQEFETVAIPGLLQTEAYAR
AVFCTAHPTASTLRIEQFVTARLDRQRILDRPDPPHIMIALDEAVLRRRVGGSRTMSEQL
GHLLAMADLPKVNVQVVPFSVREHPGSMTPFRIMGFCEGPEFLYGESFIGGQVTTDVHQL
GQHHLAFNLIQARALSPQDSRVLIRRLRKEMEGGPD
selected fasta
>putative DNA-binding protein [SCC75A.25c]
ATGCAGTCGCGCGGTGACGATCTGTCCTCAGCGCTGAGCCGCTTCGCGGACGCCGCACAG
CGGTGCCGGTTGGCGGCCGGGCTCTCCCGCGAGGAGGTCGCCGAGCGGACGCGGTGCGCC
GAGGCGGACGTCGAACGGATCGAGAACGCCGAGCAGATGCCCTCCCGCAGCTACGCTGTG
GAGGCCGACCGGCTTCTCGGCGCGGACGGCGCTCTGGTGGCCCTGTGGCCGCCTCTCGTC
AGATCCGCCTATCCCGAGTGGTTCTGGCAGGTCGTCGAGTTGGAGCAGCAGGCCAGCTTC
GTCCAGGAATTCGAGACTGTCGCCATACCTGGTCTGCTACAGACGGAGGCCTACGCTCGT
GCCGTCTTCTGCACCGCCCATCCGACAGCCTCGACGCTGCGGATCGAGCAGTTCGTGACC
GCCCGGCTGGACCGGCAGCGCATCCTGGACAGACCCGATCCGCCGCACATCATGATCGCG
CTCGATGAGGCGGTGCTGCGTCGCCGCGTCGGTGGGAGCCGGACCATGAGCGAGCAGCTC
GGACACCTGCTGGCGATGGCCGACCTGCCCAAGGTGAACGTACAGGTCGTCCCGTTCAGC
GTGCGTGAGCACCCCGGGAGCATGACTCCCTTTCGCATCATGGGCTTCTGCGAGGGTCCG
GAGTTCTTGTACGGGGAGTCGTTCATCGGAGGCCAGGTGACCACCGACGTCCACCAACTC
GGGCAGCACCACCTGGCGTTCAACCTGATCCAGGCGCGTGCGCTGTCCCCGCAGGACTCG
CGCGTCCTGATCCGTCGGCTGAGGAAGGAAATGGAAGGTGGACCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001387 Helix-turn-helix type 3 (Domain)
 [18-73]  8.20000406808458e-07 SM00530
SM00530   HTH_XRE
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [21-67]  3.7e-06 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
SignalP
 [1-34]  0.091 Signal
Bacteria, Gram-negative   
 [1-27]  0.046 Signal
Eukaryota   
TMHMM No significant hit
first first   Aran_00020 Aran_00020