close all open/close all

CDS information : Aran_00020


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction2,680 / 2,069 / - [in whole cluster]
2,680 / 2,069 / - [in contig]
Locationcomplement(2069..2680) [in whole cluster]
complement(2069..2680) [in contig]
TypeCDS
Length612 bp (203 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in aranciamycin biosynthesis.
Note (GenBank)
  • orf2
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MAYLHDPNRRAVPPATQSHGRQLPRQRPPTPYVRDEPEPSAPLAARADAGAGVAGCRSSV
CSDCNLGFGRHVHLHLPSAAAEVARARALAGAALTSWGCPQGVVDDGRLLVSELLANAVT
HAPGTWITLDVMQIGDRLWVEVTDGSTTQPVVRQADPQEEQGRGMFLVEAIASAWGAHRE
RRGRKTTWCTLAVVGRGKTPPPR
selected fasta
>hypothetical protein [hypothetical protein]
ATGGCGTACCTTCATGACCCGAACCGCCGCGCAGTCCCTCCTGCCACACAGTCGCACGGC
AGGCAGTTGCCTCGGCAACGGCCGCCCACGCCGTACGTCCGCGACGAGCCGGAGCCGTCT
GCGCCGCTCGCCGCACGCGCCGACGCCGGCGCAGGGGTGGCCGGCTGCCGCAGTTCAGTG
TGCTCCGACTGCAACCTGGGCTTCGGTCGGCATGTGCACCTCCATCTGCCGTCGGCGGCG
GCCGAGGTGGCAAGGGCACGCGCCCTGGCCGGAGCTGCCCTGACCTCGTGGGGCTGCCCG
CAGGGAGTCGTGGACGACGGCCGTTTGCTCGTCAGCGAGTTGCTCGCGAACGCGGTCACA
CACGCACCCGGTACATGGATCACCCTGGACGTGATGCAGATCGGCGACCGTCTGTGGGTG
GAAGTCACGGACGGGTCCACGACACAACCCGTCGTCCGTCAGGCGGATCCGCAGGAGGAG
CAGGGCAGGGGGATGTTCCTGGTGGAGGCGATCGCCTCGGCCTGGGGTGCGCACCGGGAG
CGCCGCGGTCGCAAGACCACCTGGTGCACCCTCGCCGTCGTCGGGCGCGGCAAGACGCCG
CCCCCTCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [68-196]  9.49999985106439e-08 SSF55874
SSF55874   ATP_bd_ATPase
 [104-195]  0.0129999995835436 SM00387
SM00387   HATPase_c
SignalP No significant hit
TMHMM No significant hit