close all open/close all

CDS information : Aran_00030


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction3,617 / 5,569 / + [in whole cluster]
3,617 / 5,569 / + [in contig]
Location3617..5569 [in whole cluster]
3617..5569 [in contig]
TypeCDS
Length1,953 bp (650 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in aranciamycin biosynthesis.
Note (GenBank)
  • orf3
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
P07788
PmId
[3135411] Identification of the promoter for a spore coat protein gene in Bacillus subtilis and studies on the regulation of its induction at a late stage of sporulation. (J Mol Biol. , 1988)
[11514528] CotA of Bacillus subtilis is a copper-dependent laccase. (J Bacteriol. , 2001)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MGSPVISRRLVLQTSLAGGMSLFCPPGTAMPRAAPAQAEVLDPAAIRKYVAELVVPPVMP
FDSRAGRDVYTIGIRQFRQQVLPPGMPATTVFGYGSTGHPETLHYPAFTIEAWYGRAVQV
RWVNQLLDPNGGHLPHILPVDPTLHWANPPGGAERRDSRPTFTSTPGPYGGPVPVVTHLH
GGANTEESDGYAEAWYLPDARGIPRGYARVGSFYQEFAKKSEAKFGVPWGPGEAVFHYAN
LSRAATMWFHDHTLGITRLNVYAGMSGLYLLRGGPSDLAEGVLPGPAPRLGDPPGKRYYE
IPVVIQDRSFRADGSLFYPASRALFDRFKGPYVPHSDIPPIWNPEYFGNAMVANGRTWPV
LPVEPRRYRLRFLNGCNARTLILKIVTDPMARRPVPAKLALWQIGSDGGFLPAPVRRDQL
LLAPAERADVVVDFSSTPVGSELYLINEGPDAVFAGGTVETGFPAANPKTTGQIMKLVIE
PLVTADTSTPPAQLTLPPVKPLGAADRTRQVSLGEVASARVRGVSPREVLLGVIGPNGEP
RLLGWADPITENPAVGSTEIWEIHNLTKDAHPIHIHEVQFQIVDRQKLPVGGRRPPEAWE
RGFKDTVLAYPQETTRVKVRFSQTGRYMWHCHLLEHEDNEMMRPLHVGPA
selected fasta
>putative oxidoreductase [oxidoreductase]
GTGGGAAGCCCAGTGATCAGCAGAAGGCTCGTGCTTCAGACCAGTCTGGCGGGCGGAATG
TCGCTCTTTTGCCCTCCCGGTACCGCTATGCCGCGGGCTGCGCCCGCGCAAGCGGAAGTC
CTTGATCCGGCGGCGATACGGAAGTACGTGGCCGAACTTGTGGTACCTCCCGTCATGCCG
TTCGACAGCCGGGCCGGCCGGGACGTCTACACGATCGGCATCCGGCAGTTCCGGCAGCAG
GTGCTTCCCCCGGGCATGCCGGCCACAACGGTGTTCGGATACGGTTCGACCGGGCATCCC
GAAACGCTCCACTATCCCGCGTTCACCATCGAAGCGTGGTACGGACGTGCGGTCCAGGTC
AGGTGGGTCAACCAACTCCTCGACCCGAACGGCGGACATCTGCCGCACATATTGCCGGTC
GATCCCACACTCCACTGGGCGAACCCACCGGGCGGGGCGGAGCGGCGGGACTCCCGTCCC
ACGTTCACTTCGACACCCGGGCCGTACGGCGGACCGGTACCCGTTGTCACCCACCTGCAC
GGCGGGGCGAACACGGAGGAGAGCGACGGATACGCCGAGGCCTGGTATTTGCCCGATGCG
CGGGGCATTCCCCGCGGTTACGCCCGAGTCGGGTCCTTCTACCAGGAGTTCGCGAAGAAG
TCCGAGGCGAAGTTCGGCGTGCCCTGGGGCCCGGGCGAGGCCGTCTTCCACTACGCCAAC
CTCAGCCGGGCCGCCACCATGTGGTTCCACGACCACACCCTGGGCATCACCCGGCTGAAC
GTGTACGCCGGAATGTCGGGCCTCTACCTGCTGCGCGGTGGGCCGTCGGATCTGGCGGAA
GGCGTCCTGCCCGGACCCGCGCCGAGGCTCGGTGACCCGCCCGGCAAGCGCTACTACGAA
ATTCCGGTCGTCATCCAGGACCGCTCGTTCCGGGCCGACGGGAGCCTGTTCTACCCCGCG
AGCCGGGCGCTCTTCGACCGGTTCAAGGGCCCCTATGTGCCCCACAGTGACATACCGCCG
ATCTGGAACCCGGAGTACTTCGGCAACGCGATGGTCGCCAACGGCAGAACCTGGCCGGTG
CTGCCCGTCGAGCCGCGCCGTTACCGACTCCGGTTCCTCAACGGCTGCAACGCACGCACT
CTGATCCTGAAGATCGTCACTGATCCGATGGCCCGCAGGCCGGTACCGGCAAAGCTTGCC
CTGTGGCAGATAGGAAGCGACGGGGGCTTCCTACCGGCCCCCGTCCGGCGCGACCAACTG
CTGCTCGCCCCGGCCGAACGCGCCGACGTCGTCGTCGACTTCTCCTCGACCCCGGTCGGC
TCGGAGCTGTACCTGATCAACGAGGGACCGGACGCCGTGTTCGCGGGGGGCACGGTCGAA
ACCGGCTTCCCCGCTGCGAACCCGAAGACCACCGGGCAGATCATGAAGCTCGTGATCGAA
CCGCTCGTCACGGCGGACACCTCGACGCCTCCCGCACAGCTCACGCTGCCACCCGTCAAG
CCCCTGGGCGCAGCAGACCGCACCCGACAGGTCAGTCTCGGCGAGGTGGCCTCAGCCCGC
GTGCGGGGCGTGAGCCCCCGCGAAGTGCTGCTCGGCGTCATCGGTCCGAACGGCGAACCG
AGGCTGTTGGGATGGGCCGATCCCATCACGGAGAACCCCGCCGTGGGGTCGACGGAGATC
TGGGAGATCCACAACCTGACGAAGGACGCCCACCCCATTCACATCCACGAAGTGCAGTTC
CAGATCGTCGACCGGCAAAAACTTCCGGTCGGCGGCCGTCGACCCCCGGAGGCGTGGGAG
CGCGGTTTCAAGGACACGGTCCTCGCCTACCCGCAGGAGACAACCCGGGTCAAGGTGCGC
TTCAGCCAGACAGGCCGGTACATGTGGCACTGCCACCTCCTGGAACACGAGGACAACGAA
ATGATGCGTCCCCTGCACGTCGGTCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-36]  PS51318
PS51318   TAT
IPR008972 Cupredoxin (Domain)
 [46-270]  6.40000000000004e-57 G3DSA:2.60.40.420 [296-441]  5.30000000000001e-61 G3DSA:2.60.40.420 [498-648]  8.50000000000004e-42 G3DSA:2.60.40.420
G3DSA:2.60.40.420   Cupredoxin
 [45-277]  6.69999687625999e-14 SSF49503 [291-435]  6.19998763505952e-26 SSF49503 [496-649]  5.49999338756182e-30 SSF49503
SSF49503   Cupredoxin
IPR011706 Multicopper oxidase, type 2 (Domain)
 [557-649]  1.69999999999999e-22 PF07731
PF07731   Cu-oxidase_2
SignalP
 [1-38]  0.906 Signal
Bacteria, Gram-negative   
 [1-29]  0.908 Signal
Eukaryota   
 [1-38]  0.999 Signal
Bacteria, Gram-positive   
TMHMM No significant hit