close all open/close all

CDS information : Aran_00040


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction8,852 / 6,024 / - [in whole cluster]
8,852 / 6,024 / - [in contig]
Locationcomplement(6024..8852) [in whole cluster]
complement(6024..8852) [in contig]
TypeCDS
Length2,829 bp (942 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AfsR family transcriptional regulator
Product (GenBank)response regulator
Gene
Gene (GenBank)
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • orf4
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
C1IC33
PmId
[19383687] polR, a pathway-specific transcriptional regulatory gene, positively controls polyoxin biosynthesis in Streptomyces cacaoi subsp. asoensis. (Microbiology. , 2009)
ACC
P25941
PmId
[2253887] Primary structure of AfsR, a global regulatory protein for secondary metabolite formation in Streptomyces coelicolor A3(2). (Gene. , 1990)
[11952895] afsS is a target of AfsR, a transcriptional factor with ATPase activity that globally controls secondary metabolism in Streptomyces coelicolor A3(2). (Mol Microbiol. , 2002)
[17434533] AfsR recruits RNA polymerase to the afsS promoter: a model for transcriptional activation by SARPs. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative AfsR family transcriptional regulator [response regulator]
MAAWFGVLGVVEVWCDGLPADVGHARQRQVLAALLVDAGQVVPADALVARVWGERAPRGG
RDVLYGYVSRLRTALAAVDVPITRTRGGYLLAVEPRTVDLHRFRDLAARAREATATSAES
AVALWEEMLGLWRGEPFAGADTPWFNAQRTRLEAERLSAQLDLTDLRLGLGRHAAVLSEC
EARARAHPLDERVAGHVMLALYRAGRAAEALARYQDIRRRLAHELGVDPGPGLRDLHRRI
LANDPALSLPEPAPRASPAGGAPPPVPRQLPAPPVHFVGRDEEIAVLDKMLAAQDEPRTA
LQLSVICGTGGVGKTWLALRWAHSRQHGFPDGQLFADLRGFTPSGKPADPSVVIRGFLDA
LGVAPERIPATSDAQAALYRSLLADRRVLVVLDNARDTEQLLPLLPGTPTCTVVITSRAQ
LTGLAASHQATHLTLDGFDSATARELLVGRLGAERVAAEADAAATLVAQCAGLPLALSVL
AARITTNPVFTLTALTEELRESDSRLDALDTGENTTTVRTVIASSYRALDPDTARVFRQF
AQVPGPDIAQAAASSLTDLPLARARRALHRLRAAHLLQELAPGRFGCHDLLRAYAIEVVG
SVDGAEGEAARVRVLEHYLHTAWSADRLLHPHRDPLRLAPAADGVRPEDLAHHDRAMTWF
TQERPALVAAVHQAARHGHETYAWQLAWALTTFLTRRGLWHDVAAVHTTALAAAERLGDA
AAQAESLRALAWERIEAGDHDAAHRRLARALSLIQDSGQVLSEAETHLALGWLHEHTGDW
AAALRHDEHAARLFTRLGHRAGLARALNAVAWDHVQRGDPRAAVSHCEQAMVIHGELDDP
RGQANTLDTLGYAYQRLGEFSEALRCHRRSLELHRALGHRPNEALDLIHLGEVHRAMGDL
SAARHAVDEAIGIYRDIEVHPARVEHARTLLASLGTTGTASQ
selected fasta
>putative AfsR family transcriptional regulator [response regulator]
ATGGCTGCGTGGTTCGGTGTGCTCGGCGTGGTCGAGGTCTGGTGCGACGGGCTGCCGGCC
GACGTGGGGCACGCACGCCAGCGGCAGGTGCTGGCGGCGTTGCTCGTCGACGCCGGACAG
GTGGTGCCGGCGGACGCGCTGGTGGCACGGGTCTGGGGGGAGCGGGCCCCGCGAGGGGGC
CGGGACGTGCTGTACGGGTATGTGTCCAGGCTCCGCACCGCGCTGGCCGCGGTGGACGTC
CCGATCACCCGGACCCGGGGCGGCTATCTGCTGGCGGTGGAGCCACGGACGGTGGACCTG
CACCGGTTCCGCGACCTCGCGGCTCGGGCCCGGGAGGCGACGGCGACGTCCGCCGAGTCC
GCGGTGGCGCTGTGGGAGGAGATGCTCGGGCTGTGGCGGGGCGAGCCGTTCGCCGGGGCG
GACACTCCGTGGTTCAACGCCCAGCGGACCCGGCTGGAGGCCGAACGGCTGTCCGCCCAG
CTCGACTTGACGGATCTGCGGCTCGGTCTGGGCCGGCACGCGGCGGTGCTGTCCGAGTGC
GAGGCACGGGCACGGGCGCACCCGCTGGACGAACGGGTGGCCGGGCATGTGATGCTCGCG
CTGTACCGCGCCGGCCGCGCCGCAGAGGCCCTCGCCCGTTACCAGGACATCCGGCGGCGG
CTGGCACACGAGCTGGGCGTCGACCCCGGACCGGGTCTGCGCGACCTCCACCGGCGGATC
CTGGCCAACGACCCGGCGCTGTCCCTGCCCGAGCCCGCCCCGCGCGCTTCTCCGGCAGGC
GGGGCACCGCCGCCTGTGCCGCGCCAGCTTCCCGCTCCCCCGGTCCACTTCGTCGGCCGT
GACGAGGAGATCGCCGTCCTGGACAAGATGCTCGCGGCCCAGGACGAGCCCCGCACCGCC
CTGCAGCTCTCGGTGATCTGCGGTACCGGCGGGGTCGGCAAGACCTGGCTCGCGCTGCGC
TGGGCCCACAGCAGACAGCACGGCTTCCCCGACGGGCAGCTCTTCGCCGACCTCCGTGGC
TTCACGCCCTCGGGGAAACCGGCAGACCCCTCCGTGGTGATCCGCGGGTTCCTCGACGCT
CTCGGCGTCGCCCCTGAGCGGATACCAGCCACCTCGGACGCCCAGGCAGCTCTGTACCGC
AGTCTCCTGGCGGACCGGCGCGTGCTCGTCGTCCTGGACAACGCCCGTGACACCGAGCAG
CTCCTGCCCCTGCTGCCGGGCACGCCCACCTGCACCGTCGTGATCACCAGCCGCGCACAG
CTCACCGGGCTCGCCGCCTCGCACCAGGCCACCCACCTGACGCTCGACGGGTTCGACTCC
GCCACGGCCCGCGAGCTGCTGGTCGGCCGGCTGGGCGCCGAACGGGTAGCCGCGGAAGCC
GACGCCGCGGCCACCCTGGTCGCCCAGTGCGCGGGACTGCCCCTGGCCCTGAGCGTCCTG
GCCGCGCGCATCACCACCAACCCGGTGTTCACCCTGACCGCCCTGACCGAGGAACTGCGC
GAGAGCGACTCCCGCCTCGACGCCCTGGACACCGGTGAGAACACCACCACCGTACGCACC
GTCATCGCCTCCTCCTACCGCGCGCTCGACCCGGACACCGCCCGCGTGTTCCGCCAGTTC
GCGCAGGTGCCCGGCCCGGACATCGCCCAGGCCGCCGCGAGCAGTCTCACGGACCTCCCC
CTCGCCCGGGCACGCCGGGCGCTGCACCGGCTGAGGGCCGCCCACCTCCTCCAGGAACTC
GCTCCCGGCCGGTTCGGCTGCCACGACCTGCTGCGCGCCTACGCCATCGAAGTCGTCGGC
TCCGTGGACGGCGCGGAGGGCGAGGCGGCCCGCGTCCGCGTCCTCGAGCACTATCTGCAC
ACCGCCTGGTCGGCCGACCGGCTCCTGCACCCGCACCGCGATCCCCTCCGCCTGGCGCCG
GCCGCCGACGGCGTGCGTCCGGAGGACCTCGCCCACCACGACCGGGCCATGACGTGGTTC
ACCCAGGAGCGCCCCGCGCTCGTCGCCGCCGTGCACCAGGCCGCCCGTCACGGTCACGAG
ACGTACGCCTGGCAACTGGCCTGGGCCCTGACGACCTTCCTGACCAGGCGGGGACTGTGG
CACGACGTCGCGGCCGTCCACACGACGGCACTGGCGGCCGCGGAACGGCTCGGTGACGCG
GCCGCCCAGGCCGAGTCCCTACGCGCACTGGCCTGGGAGCGCATCGAGGCGGGGGACCAC
GACGCGGCGCACCGCCGACTGGCCCGGGCTCTGTCCCTGATCCAGGACAGCGGCCAGGTC
CTGTCCGAGGCGGAGACCCACTTGGCCCTCGGCTGGCTCCACGAGCACACGGGTGACTGG
GCGGCGGCGTTGCGCCACGACGAGCACGCGGCCCGCCTGTTCACGCGGCTGGGCCACCGG
GCCGGACTCGCGCGCGCCCTGAACGCGGTGGCGTGGGACCACGTGCAGCGGGGCGATCCC
CGAGCGGCCGTGTCCCACTGCGAACAGGCCATGGTCATCCACGGGGAGCTCGACGACCCG
CGCGGGCAGGCCAACACCCTGGACACGCTCGGCTACGCCTACCAACGGCTCGGTGAGTTC
TCCGAGGCCCTCAGGTGTCACCGGCGCAGCCTGGAACTCCACAGAGCCCTGGGCCACCGT
CCCAACGAGGCCTTGGACCTCATCCATCTCGGGGAGGTGCACCGGGCCATGGGTGACCTG
AGCGCCGCGAGGCACGCGGTCGACGAAGCCATCGGCATCTACCGGGACATCGAGGTCCAC
CCCGCACGCGTGGAGCACGCGCGCACGCTGCTCGCCTCCCTGGGCACGACCGGCACCGCC
TCCCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [303-318]  2.59999946718995e-09 PR00364 [382-396]  2.59999946718995e-09 PR00364 [470-484]  2.59999946718995e-09 PR00364
PR00364   DISEASERSIST
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [17-91]  1.80000149287196e-09 SM00862
SM00862   Trans_reg_C
 [26-90]  1.7e-09 PF00486
PF00486   Trans_reg_C
IPR002182 NB-ARC (Domain)
 [299-544]  8.50000000000001e-13 PF00931
PF00931   NB-ARC
IPR005158 Bacterial transcriptional activator domain (Domain)
 [98-241]  3.99999999999998e-40 PF03704
PF03704   BTAD
 [98-241]  1.20000117458134e-48 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [749-916]  9.8e-34 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [25-94]  1.2e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR013026 Tetratricopeptide repeat-containing domain (Domain)
 [724-917]  PS50293
PS50293   TPR_REGION
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [2-92]  1.49999977583352e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
IPR019734 Tetratricopeptide repeat (Repeat)
 [764-797]  0.210000008441252 SM00028 [804-837]  0.0609999977126211 SM00028 [844-877]  4.19999771339581e-05 SM00028 [884-917]  0.0510000022429626 SM00028
SM00028   TPR
 [724-757]  PS50005 [764-797]  PS50005 [844-877]  PS50005 [884-917]  PS50005
PS50005   TPR
SignalP
 [1-15]  0.952 Signal
Eukaryota   
TMHMM No significant hit