close all open/close all

CDS information : Aran_00050


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction11,256 / 9,913 / - [in whole cluster]
11,256 / 9,913 / - [in contig]
Locationcomplement(9913..11256) [in whole cluster]
complement(9913..11256) [in contig]
TypeCDS
Length1,344 bp (447 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf5
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
P48635
PmId
[8416893] Identification of a Saccharopolyspora erythraea gene required for the final hydroxylation step in erythromycin biosynthesis. (J Bacteriol. , 1993)
[7849045] Overproduction and characterization of the erythromycin C-12 hydroxylase, EryK. (Biochemistry. , 1995)

close this sectionSequence

selected fasta
>putative cytochrome P450 [oxidoreductase]
MRVACNCFACVRPVCVRTVCVHAVCVRVVLITAESSPTRWHEETSLMDGPHFPDAMRRTL
AHYARMRRDEPVSHDPVSGRWQVFRYADGLRVMQDSETFSNDMSEFMPPVEELSAFQQGN
FQNMDMPRHRELRGLVSQAFTPRFVADLEPRIREVTRQLLDAADARGDTMDVVADLAHPL
PVTVIAEVVGLPREDHGLFRKWAYALLVDNGVDAIRSEEGVAAMAPAIREMNDYLGGHVR
RHRTIEGSGLLHDLIRAEADGRRLNDQEIVGFLGLLLIAGFLTTSALLGNAVLCFDEHPE
ATARLRADPELLPTAIEEVLRYRSPLIWLTAGRPGRPGSSGHVVPEGALVSVALVSAARD
GEAFPDPDTFDITRRPNRHLSFGKGAHVCLGAPLARLEARVALTELLRRYPDFAVSPSTE
EPLLFHDPDGLQAATRLPLRVNRALVR
selected fasta
>putative cytochrome P450 [oxidoreductase]
ATGCGCGTTGCGTGCAATTGCTTTGCGTGCGTTCGCCCTGTCTGCGTTCGCACTGTGTGT
GTTCACGCTGTCTGTGTTCGCGTTGTGTTGATCACCGCCGAGTCCAGTCCTACCCGATGG
CACGAGGAGACCTCACTGATGGACGGCCCGCACTTCCCCGACGCCATGCGGCGCACGCTC
GCCCACTACGCGCGCATGCGCCGTGACGAGCCGGTCAGTCACGACCCCGTGTCCGGGCGG
TGGCAGGTGTTCCGCTACGCGGACGGACTGCGGGTGATGCAGGACTCCGAGACGTTCTCC
AACGACATGAGCGAGTTCATGCCCCCGGTGGAGGAGCTCTCCGCGTTCCAGCAGGGCAAC
TTCCAGAACATGGACATGCCCCGGCACCGGGAGCTCCGCGGCCTGGTCAGCCAGGCCTTC
ACCCCCCGCTTCGTGGCGGACCTCGAGCCCCGGATCCGGGAGGTGACCCGGCAGTTGCTG
GACGCCGCCGACGCCCGCGGCGACACCATGGACGTGGTCGCCGACCTCGCGCATCCGCTG
CCCGTGACGGTCATTGCCGAGGTGGTGGGGCTGCCCCGCGAGGACCACGGCCTCTTCCGC
AAGTGGGCGTACGCCCTGTTGGTGGACAACGGGGTCGACGCGATCCGCAGCGAGGAGGGC
GTGGCCGCCATGGCTCCGGCCATCCGGGAGATGAACGACTACCTCGGCGGCCATGTACGG
CGTCACCGGACCATCGAAGGATCGGGCCTGCTGCACGACCTCATCCGGGCGGAGGCCGAC
GGCCGGCGGCTGAACGACCAGGAGATCGTGGGCTTCCTGGGTCTGCTGCTGATCGCCGGG
TTCCTCACCACCAGCGCGCTCCTCGGCAACGCCGTGCTCTGCTTCGACGAGCACCCCGAG
GCCACTGCGCGGCTGCGCGCGGATCCGGAACTGCTGCCCACCGCCATCGAGGAGGTGCTG
CGCTACCGGTCGCCGCTGATCTGGCTGACCGCCGGGCGGCCCGGGAGACCCGGCTCGAGC
GGTCATGTCGTCCCGGAGGGGGCGCTGGTCAGCGTCGCCCTGGTGTCGGCGGCCCGGGAC
GGGGAGGCCTTCCCCGACCCGGACACCTTCGACATCACCCGCCGGCCCAACCGCCACCTG
TCGTTCGGCAAGGGCGCCCATGTGTGCCTGGGCGCTCCGCTCGCCCGGCTGGAGGCGCGG
GTGGCCCTGACCGAGCTGCTGCGCCGCTATCCCGACTTCGCCGTGTCCCCGTCCACCGAG
GAGCCGCTGCTGTTCCACGACCCGGACGGGCTGCAGGCGGCCACCCGTCTGCCGCTGCGG
GTCAACCGGGCCCTGGTGCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [43-443]  1.09999184471405e-80 SSF48264
SSF48264   Cytochrome_P450
 [51-441]  3.39999999999996e-97 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [250-428]  1.99999999999999e-20 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [124-135]  1.99999636034521e-38 PR00359 [171-187]  1.99999636034521e-38 PR00359 [188-203]  1.99999636034521e-38 PR00359 [233-255]  1.99999636034521e-38 PR00359 [314-325]  1.99999636034521e-38 PR00359 [359-374]  1.99999636034521e-38 PR00359 [380-389]  1.99999636034521e-38 PR00359 [389-400]  1.99999636034521e-38 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [382-391]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-33]  0.492 Signal
Bacteria, Gram-positive   
TMHMM
 [269-291]  Transmembrane (i-o)
Transmembrane 1