close all open/close all

CDS information : Aran_00070


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction13,039 / 12,254 / - [in whole cluster]
13,039 / 12,254 / - [in contig]
Locationcomplement(12254..13039) [in whole cluster]
complement(12254..13039) [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)ketoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf7
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
Q8VWB5
PmId
[8157619] Nucleotide sequence of the aknA region of the aklavinone biosynthetic gene cluster of Streptomyces galilaeus. (J Bacteriol. , 1994)
ACC
Q56166
NITE
Jado_00110
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)
ACC
Q54812
NITE
Adria_00250
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [ketoreductase]
MVNDDRRVALVTGATSGIGLSVARDLARAGLAVFLCARDTDAVKRTVEELRAVGHEADGT
SCDVRDKTSVRALVDSALGAYGRVDVLVNNAGRNGGGVTADLPDETWYDVIDTNLNSVFL
VTREVLKRSGMRERGWGRVISIASTGGKQGVVLAAPYSASKHGVIGFSKALGKELAPTGV
TVNAVCPGYVETPMAQRVRAGYAAAWETTEEDVLEQFQAKIPLGRYSTPEEVAGLVGYLV
SDTAASITAQALNVCGGLGNY
selected fasta
>putative polyketide C-9 ketoreductase [ketoreductase]
ATGGTGAACGACGATCGGCGGGTGGCCCTCGTCACGGGCGCCACCAGCGGCATCGGGCTG
TCCGTCGCCCGGGACCTGGCCCGCGCGGGCCTGGCGGTGTTCCTCTGCGCCCGGGACACG
GACGCCGTGAAGCGGACGGTGGAGGAACTGCGGGCCGTCGGTCACGAGGCCGACGGCACG
TCGTGCGACGTACGGGACAAGACCTCGGTCCGGGCCCTGGTGGACTCCGCCCTCGGGGCG
TACGGCCGGGTCGACGTCCTGGTGAACAACGCCGGCCGCAACGGCGGCGGGGTCACCGCC
GATCTCCCCGACGAGACCTGGTACGACGTCATCGACACCAACCTCAACAGCGTCTTCCTG
GTCACCCGTGAGGTGCTCAAGCGCTCCGGTATGCGGGAGCGCGGCTGGGGCCGGGTCATC
AGCATCGCCTCCACCGGCGGCAAACAGGGCGTGGTGCTCGCGGCGCCCTACTCGGCGTCC
AAGCACGGGGTGATCGGCTTCTCCAAAGCGCTCGGCAAGGAGCTCGCGCCGACCGGCGTC
ACCGTCAACGCGGTGTGCCCGGGCTACGTCGAGACCCCGATGGCCCAGCGGGTGCGGGCC
GGCTACGCCGCCGCCTGGGAGACCACCGAGGAGGACGTACTGGAGCAGTTCCAGGCCAAG
ATCCCGCTGGGGCGCTACTCCACGCCGGAGGAGGTGGCCGGCCTCGTCGGCTATCTGGTG
AGCGACACGGCGGCGTCCATCACGGCCCAGGCGCTGAACGTCTGCGGCGGCCTGGGCAAC
TACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1-261]  9.5000102816722e-16 PIRSF000126
PIRSF000126   11-beta-HSD1
 [8-175]  7.10000000000008e-35 PF00106
PF00106   adh_short
 [82-93]  2.19999900980708e-13 PR00080 [137-145]  2.19999900980708e-13 PR00080 [157-176]  2.19999900980708e-13 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  5.50001754266469e-47 PR00081 [82-93]  5.50001754266469e-47 PR00081 [131-147]  5.50001754266469e-47 PR00081 [157-176]  5.50001754266469e-47 PR00081 [178-195]  5.50001754266469e-47 PR00081 [222-242]  5.50001754266469e-47 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [6-258]  6.70000000000005e-82 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [144-172]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit