close all open/close all

CDS information : Aran_00090


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction14,120 / 13,854 / - [in whole cluster]
14,120 / 13,854 / - [in contig]
Locationcomplement(13854..14120) [in whole cluster]
complement(13854..14120) [in contig]
TypeCDS
Length267 bp (88 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)acyl carrier protein
Gene
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • ACP; orf9
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
Q54219
NITE
Griseu_00030
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9108302] Post-translational modification of heterologously expressed Streptomyces type II polyketide synthase acyl carrier proteins. (FEBS Lett. , 1997)
[9738947] Acylation of Streptomyces type II polyketide synthase acyl carrier proteins. (FEBS Lett. , 1998)

close this sectionPKS/NRPS Module

ACP5..78

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
MAEMTLEQLTGLLRECAGEEEGVDLDGDVLDRAFTDLGYDSLAVLQVIGRVEQDYGLTLP
DEVVAEATTPRQFLARVNDGLSEVPRPA
selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
ATGGCGGAGATGACCCTTGAGCAACTCACCGGCCTGCTGCGCGAGTGCGCGGGCGAGGAG
GAAGGGGTGGACCTGGACGGCGACGTCCTGGACCGCGCCTTCACCGACCTCGGCTACGAC
TCCCTGGCGGTGCTGCAGGTGATCGGCCGTGTCGAGCAGGACTACGGCCTCACGCTGCCG
GACGAGGTGGTGGCGGAGGCGACGACGCCACGCCAGTTCCTGGCGCGCGTGAACGACGGT
CTGAGCGAGGTGCCTCGGCCGGCGTGA
ACP5..78
ACP13..234

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [36-51]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [5-78]  PS50075
PS50075   ACP_DOMAIN
 [1-81]  2.800005042611e-17 SSF47336
SSF47336   ACP_like
 [5-81]  5.59999999999999e-16 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [13-77]  8.60000000000001e-11 PF00550
PF00550   PP-binding
SignalP
 [1-18]  0.094 Signal
Eukaryota   
TMHMM No significant hit