close all open/close all

CDS information : Aran_00100


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction15,370 / 14,144 / - [in whole cluster]
15,370 / 14,144 / - [in contig]
Locationcomplement(14144..15370) [in whole cluster]
complement(14144..15370) [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)chain length factor
Gene
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • CLF; orf10
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
Q56164
NITE
Jado_00090
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionPKS/NRPS Module

CLF8..363

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
MSSTASPVFTGIGVTAPNGLGTEAWWRATLAGEHGIRPVSRFDATGYPATLAGEVPDYEP
ERRIPSRLLPQTDHMTRLALTAAEEALSDAKVDPDGLPEYTAGVVTAASAGGFEFGQREL
QALWSKGGQFVSAYQSFAWFYAVNTGQISIRHGLRGPSGVLVTEQAGGLDVVAQARRQLR
KGSALMVTGGVDGSVCPWGWTGHLAGGRMSTVAEPERAYLPFARDARGHVAGEGGAILIL
EDAAAARARGARTYGALAGYAATFDPAPGTGAEPGLRRAVELALDDAGLAAGDIDVVFAD
GAGIRDLDRQEADALARVFGPRGVPVTVPKTMTGRLLAGGAALDLAAALLSVHEGLIPPT
AHVTSPADDCPVDLVTAVRSGPVRHALVLARGHGGFNAAAVVTAVSDS
selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
ATGAGCAGCACGGCATCCCCGGTCTTCACCGGCATCGGCGTCACGGCCCCCAACGGGCTG
GGCACCGAGGCCTGGTGGCGGGCCACCCTGGCGGGCGAGCACGGCATCCGTCCGGTCTCC
CGCTTCGACGCCACCGGCTATCCGGCCACCCTCGCCGGCGAGGTGCCCGACTACGAGCCG
GAGCGGCGCATCCCCAGCCGGCTGCTGCCGCAGACCGATCACATGACCCGGCTCGCGCTC
ACCGCCGCCGAGGAGGCGCTCTCCGACGCCAAGGTGGATCCGGACGGCCTGCCGGAGTAC
ACCGCCGGCGTGGTCACCGCCGCCTCGGCCGGTGGGTTCGAGTTCGGCCAGCGCGAGTTG
CAGGCCCTGTGGAGCAAGGGCGGACAGTTCGTCAGCGCGTACCAGTCCTTCGCCTGGTTC
TACGCCGTCAACACCGGCCAGATCTCCATCAGGCACGGGCTGCGCGGGCCGAGCGGCGTC
CTGGTCACCGAGCAGGCCGGCGGACTGGACGTGGTGGCCCAGGCCCGCCGTCAGCTGCGC
AAGGGCAGCGCGCTGATGGTGACCGGAGGCGTCGACGGGTCCGTCTGCCCCTGGGGCTGG
ACCGGTCATCTGGCAGGCGGACGCATGAGCACCGTCGCCGAACCGGAGCGCGCCTACCTG
CCGTTCGCCCGTGACGCCCGCGGCCATGTGGCCGGCGAGGGGGGCGCGATCCTGATCCTG
GAGGACGCCGCCGCGGCCCGGGCGCGCGGTGCCCGGACGTACGGCGCACTCGCCGGCTAC
GCCGCCACGTTCGACCCGGCGCCCGGCACCGGCGCCGAGCCCGGACTGCGCCGGGCGGTG
GAACTGGCTCTGGACGACGCCGGACTCGCCGCCGGCGACATCGACGTGGTCTTCGCCGAC
GGCGCCGGGATCCGCGACCTCGACCGGCAGGAGGCCGACGCCCTGGCGCGGGTCTTCGGT
CCCCGGGGCGTGCCGGTGACCGTCCCCAAGACGATGACCGGGCGGCTGCTGGCCGGTGGC
GCGGCCCTGGACCTGGCGGCGGCGCTGCTGTCGGTCCACGAGGGGCTGATCCCGCCGACC
GCCCATGTGACCTCCCCCGCCGACGACTGCCCCGTCGACCTGGTCACCGCCGTACGCAGC
GGCCCGGTACGCCACGCGCTGGTGCTCGCGCGCGGCCACGGCGGGTTCAACGCGGCCGCG
GTGGTGACCGCCGTGTCCGACAGCTGA
CLF8..363
CLF22..1089

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [8-244]  2.50000000000001e-52 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [254-363]  4.2e-25 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [8-258]  1.9e-50 G3DSA:3.40.47.10 [272-405]  5.40000000000002e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [4-251]  3.39999972437719e-57 SSF53901 [214-405]  7.40000780398342e-44 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit