close all open/close all

CDS information : Aran_00110


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction16,638 / 15,367 / - [in whole cluster]
16,638 / 15,367 / - [in contig]
Locationcomplement(15367..16638) [in whole cluster]
complement(15367..16638) [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)ketoacyl synthase
Gene
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • KS; orf11
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS3..376

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase]
MSRRVAITGIGVVAPGGSGGTKPFWSLLTEGRTATRTISLFDASSFRSRVAAEVDFDPVA
SGLRPQEIRRMDRAAQFAVVAAREAVADSGLETAGTDPCRTGVTIGSAVGATMGLDSEYA
VVSDGGATWLVDHTYAVPHLFDFFVPSSFAREVAWAVGAQGPTALVSTGCTSGLDSVGHA
VELIREGSADVMVAGATDAPVSPISVACFDAIKATTPRNDDAAHASRPFDRTRNGFVLGE
GAAVFVLEELERARARGAHVYAEIAGFASRSNAYHMTGLRADGAEMAEAIRSALDDARTD
PTDVDYVNAHGSGTKQNDRHETAAFKRSLGEQAYAVPVSSIKSMIGHSLGAIGALEIAAC
ALAVEHGVVPPTANLHEPDPECDLDYTPLTARETRVDTVLTVGSGFGGFQSAMVLTRPDR
RAA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase]
ATGAGCAGGCGCGTGGCCATCACCGGAATCGGGGTCGTCGCCCCCGGCGGAAGCGGCGGG
ACCAAGCCGTTCTGGTCGCTGCTGACCGAGGGACGCACCGCCACCCGCACCATCTCCCTG
TTCGACGCCTCGTCGTTCCGCTCCCGGGTGGCCGCCGAGGTCGACTTCGATCCCGTCGCC
TCCGGACTGCGTCCGCAGGAGATCCGGCGCATGGACCGCGCGGCGCAGTTCGCCGTGGTA
GCCGCCCGTGAGGCGGTGGCGGACAGCGGGCTGGAGACGGCCGGCACGGACCCCTGCCGC
ACCGGCGTCACCATCGGCAGCGCCGTCGGGGCCACGATGGGCCTGGACAGCGAGTACGCG
GTGGTCAGCGACGGCGGTGCCACCTGGCTGGTGGACCACACGTACGCCGTTCCCCACCTG
TTCGACTTCTTCGTCCCCAGTTCCTTCGCCCGGGAGGTGGCCTGGGCGGTCGGCGCACAG
GGCCCGACGGCGCTGGTCTCCACCGGCTGCACCTCCGGCCTCGACTCCGTCGGGCACGCG
GTGGAACTCATCCGTGAGGGCAGCGCGGACGTCATGGTGGCCGGGGCCACCGACGCCCCC
GTCTCGCCCATCTCCGTCGCCTGCTTCGACGCGATCAAGGCGACCACCCCGCGCAACGAC
GACGCGGCCCACGCCTCCCGGCCCTTCGACCGGACCCGCAACGGGTTCGTGCTGGGCGAG
GGCGCGGCCGTGTTCGTCCTGGAGGAACTGGAGCGGGCCCGCGCCCGCGGCGCCCATGTG
TACGCCGAGATCGCCGGGTTCGCCTCGCGCAGCAACGCGTACCACATGACGGGCCTGCGT
GCGGACGGCGCCGAGATGGCCGAGGCGATCCGTAGCGCCCTCGACGACGCCCGGACCGAC
CCCACCGACGTCGACTACGTCAACGCCCACGGTTCGGGCACCAAGCAGAACGACCGGCAC
GAGACCGCCGCGTTCAAACGCAGCCTGGGTGAGCAGGCCTACGCCGTCCCGGTCAGCTCG
ATCAAGTCGATGATCGGCCACTCGCTGGGCGCGATCGGCGCGCTGGAGATCGCCGCCTGC
GCGCTCGCCGTCGAGCACGGCGTCGTACCGCCGACCGCGAACCTGCATGAGCCCGACCCG
GAGTGTGACCTGGACTACACGCCGCTGACGGCGCGCGAGACACGGGTGGACACGGTGCTG
ACGGTCGGCAGTGGATTCGGCGGCTTCCAGAGCGCCATGGTGCTCACCCGCCCGGATCGG
AGGGCCGCATGA
KS3..376
KS7..1128

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-253]  1.40000000000001e-59 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-376]  9.20000000000001e-40 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-266]  1.5e-63 G3DSA:3.40.47.10 [271-419]  4.30000000000003e-54 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-420]  4.30000170645869e-70 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [161-177]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.901 Signal
Eukaryota   
TMHMM No significant hit