close all open/close all

CDS information : Aran_00140


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction19,957 / 18,737 / - [in whole cluster]
19,957 / 18,737 / - [in contig]
Locationcomplement(18737..19957) [in whole cluster]
complement(18737..19957) [in contig]
TypeCDS
Length1,221 bp (406 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)signal transduction histidine kinase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf14
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
O34757
PmId
[15090506] The membrane fluidity sensor DesK of Bacillus subtilis controls the signal decay of its cognate response regulator. (J Bacteriol. , 2004)
Family/Domain
FD
IPR011712

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [signal transduction histidine kinase]
MRGLRRGALVPWWPVLIVVLLQCGLALAGLSAMLGTGATATAVVAWAVLLPPLVVLQVHH
TLHGAVLARRRRRWAGVVAQAALTYLPVLVWGVEWPAMAGFAAGSAQAVLNGPAGNVSFA
VIVAVAWPVAVGSGLPQYQAATVTAVTAAVGLGVAALMRMAWRLCRLDHARDTAVRDAAH
QERLRIARDLHDLVASRLTMAALRGELAERYLTGQDERARAELRTAVELARDALTDVRSL
AHGIQTLSLSGELNVARATLRAVGVDVTIRREPCRLAAEVENVLAAALREAVTNLLRHST
AGRCRITVRRRNGQVVLCVANDGVPEELRVPARERWELPRERRGLGNLSGRASAVGGSCT
TAVTPDGWFLLTVACPVLRTDPQLRAASPRPGLSGPRRDDCAPRAS
selected fasta
>putative two-component system histidine kinase [signal transduction histidine kinase]
GTGCGGGGCTTGCGTAGGGGAGCCTTGGTTCCGTGGTGGCCGGTACTGATCGTCGTGCTC
CTGCAGTGCGGGCTGGCCCTTGCCGGACTTTCGGCCATGCTCGGCACCGGGGCCACGGCC
ACCGCGGTGGTGGCCTGGGCGGTGTTGCTGCCCCCCTTGGTGGTCCTTCAGGTCCATCAC
ACGCTGCACGGCGCGGTCCTGGCGAGACGGCGCCGCCGGTGGGCCGGCGTGGTGGCGCAG
GCGGCTCTCACCTATCTGCCGGTGCTGGTCTGGGGAGTGGAGTGGCCGGCCATGGCCGGG
TTCGCCGCCGGGTCGGCGCAGGCGGTGCTCAACGGCCCGGCCGGGAACGTGTCGTTCGCG
GTCATCGTGGCGGTCGCGTGGCCGGTCGCCGTGGGCAGCGGGCTGCCGCAGTACCAGGCG
GCGACCGTCACGGCGGTGACCGCCGCGGTGGGTCTGGGGGTGGCGGCCCTGATGCGGATG
GCCTGGCGGCTGTGCCGGCTGGACCACGCCCGGGACACCGCGGTGCGCGACGCCGCCCAT
CAGGAGCGGCTGCGGATCGCCCGGGACCTGCACGATCTGGTGGCGAGCCGGCTCACCATG
GCCGCCCTCCGCGGTGAGCTGGCCGAACGCTATCTGACGGGGCAGGACGAGCGGGCCCGC
GCCGAGCTGCGCACGGCGGTCGAACTCGCCCGAGACGCGCTGACCGATGTGCGGTCGCTG
GCCCACGGGATCCAGACGCTGTCGCTGTCCGGGGAACTGAACGTGGCCCGCGCCACCTTG
CGGGCGGTGGGCGTGGACGTGACCATCCGCAGGGAGCCCTGCCGGCTGGCGGCCGAGGTC
GAGAACGTGCTCGCGGCGGCCCTGCGGGAGGCGGTGACCAACCTGCTGCGGCACAGCACG
GCCGGCCGGTGCCGTATTACGGTGCGCCGCAGGAACGGCCAGGTCGTGCTGTGCGTGGCC
AACGACGGCGTGCCCGAGGAGCTGCGGGTGCCGGCGCGGGAGCGGTGGGAGCTGCCGCGG
GAGCGGCGCGGGCTGGGCAATCTGTCCGGCCGGGCGAGCGCCGTCGGCGGGTCGTGCACG
ACGGCCGTGACCCCCGACGGCTGGTTCCTGCTCACCGTGGCCTGCCCCGTGCTCCGCACG
GATCCGCAGCTCAGGGCAGCCAGCCCGCGTCCTGGGCTATCCGGACCGCGTCGAGACGAC
TGCGCGCCCCGAGCTTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [279-379]  0.0460000044330862 SM00387
SM00387   HATPase_c
 [244-377]  2.79999889404114e-07 SSF55874
SSF55874   ATP_bd_ATPase
 [253-324]  0.00055 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
IPR011712 Signal transduction histidine kinase, subgroup 3, dimerisation and phosphoacceptor domain (Domain)
 [182-246]  9.40000000000003e-14 PF07730
PF07730   HisKA_3
SignalP
 [1-47]  0.969 Signal
Bacteria, Gram-negative   
 [1-28]  0.659 Signal
Eukaryota   
 [1-42]  0.973 Signal
Bacteria, Gram-positive   
TMHMM
 [7-29]  Transmembrane (i-o) [34-56]  Transmembrane (o-i) [76-98]  Transmembrane (i-o) [113-135]  Transmembrane (o-i) [140-162]  Transmembrane (i-o)
Transmembrane 5