close all open/close all

CDS information : Aran_00160


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction21,987 / 21,568 / - [in whole cluster]
21,987 / 21,568 / - [in contig]
Locationcomplement(21568..21987) [in whole cluster]
complement(21568..21987) [in contig]
TypeCDS
Length420 bp (139 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-12 oxygenase
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
  • anthraquinone
Note
  • orf16
Note (GenBank)
Reference
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
O54259
NITE
Nogl_00350
PmId
[19255477] Expression, purification and crystallization of the cofactor-independent monooxygenase SnoaB from the nogalamycin biosynthetic pathway. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2009)
[20052967] Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism. (Biochemistry. , 2010)
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)

close this sectionSequence

selected fasta
>putative C-12 oxygenase
MAGPRSALPPRPFEPLSSGADHDGGRGFEPARQEATLVITFVNRFDVHGSPAEFERVFDR
TSLFFSAQPGFLRHRLLRHADQPGKYVNVAEWESRAAFEQALRQPEFAPHARDLRELSTS
DPQLYVSALERSEPQRPHA
selected fasta
>putative C-12 oxygenase
GTGGCCGGCCCTCGATCGGCCTTGCCACCACGGCCGTTCGAGCCCCTGTCGAGCGGTGCC
GACCACGATGGTGGTCGTGGATTCGAGCCCGCCCGGCAGGAGGCAACTCTGGTGATCACC
TTCGTCAACCGCTTCGACGTGCACGGCTCCCCCGCCGAGTTCGAGCGCGTCTTCGACCGG
ACCTCGCTGTTCTTCAGCGCCCAGCCCGGCTTTCTGCGGCACCGGCTGCTGCGCCACGCG
GACCAGCCCGGCAAGTACGTCAACGTTGCGGAGTGGGAGAGCCGCGCGGCCTTCGAACAG
GCGTTGCGTCAGCCGGAGTTCGCTCCGCACGCCCGGGACCTGCGGGAACTGAGCACCAGC
GATCCCCAGCTGTACGTCAGCGCCCTCGAGCGCTCCGAGCCGCAGCGGCCGCACGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [39-112]  1.2e-17 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [38-139]  9.6e-20 SSF54909
SSF54909   Dimeric alpha+beta barrel
SignalP No significant hit
TMHMM No significant hit