close all open/close all

CDS information : Aran_00170


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction22,646 / 21,990 / - [in whole cluster]
22,646 / 21,990 / - [in contig]
Locationcomplement(21990..22646) [in whole cluster]
complement(21990..22646) [in contig]
TypeCDS
Length657 bp (218 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf17
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTARVEQGGRTYQVALCLPVFTEEQWQAGVRALAGQIQHAASLLQGRMPENIDETFGKAG
FTLFPRRGEFSSRCGCRDTGDPCVHGAALHYTFAGALDDNPFLLPALRGQNREELLARLR
AARSGSSAQPSAATDRLPADEAFFAGGDLTQVPLHPVPPSAPDHLIRRLGPPPAGEPGDT
EALAALARRAAAYAWEVLRAEEARRSGSGSGSGSGSGS
selected fasta
>hypothetical protein [unknown]
GTGACCGCCCGGGTGGAACAGGGCGGACGCACCTACCAGGTGGCGCTCTGCCTGCCGGTG
TTCACCGAGGAGCAGTGGCAGGCGGGGGTGCGGGCCCTGGCCGGCCAGATCCAGCATGCG
GCGAGCCTGTTGCAGGGGCGGATGCCGGAGAACATCGACGAGACGTTCGGGAAGGCGGGG
TTCACGCTGTTCCCGCGCCGCGGTGAGTTCTCCTCGCGGTGCGGATGCCGGGACACCGGT
GATCCGTGCGTGCACGGCGCCGCCTTGCACTACACCTTCGCCGGCGCCCTGGACGACAAC
CCGTTCCTGCTGCCCGCGCTGCGCGGCCAGAACCGGGAGGAACTGCTCGCCCGGCTGCGT
GCCGCCCGCAGCGGCTCCTCGGCCCAGCCCTCGGCCGCGACCGACCGGCTGCCCGCGGAC
GAGGCGTTCTTCGCCGGCGGCGACCTGACCCAGGTCCCTCTGCACCCGGTGCCTCCCTCC
GCACCGGATCACCTGATCCGCCGCCTCGGCCCTCCGCCCGCCGGCGAGCCCGGTGACACG
GAGGCCCTCGCCGCGCTCGCCCGTCGCGCGGCCGCGTACGCCTGGGAGGTCCTGCGGGCC
GAGGAAGCACGAAGGTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007527 Zinc finger, SWIM-type (Domain)
 [61-94]  PS50966
PS50966   ZF_SWIM
SignalP
 [1-28]  0.081 Signal
Bacteria, Gram-negative   
TMHMM No significant hit